summaryrefslogtreecommitdiff
diff options
context:
space:
mode:
-rw-r--r--docs/openvg.html48
-rw-r--r--include/VG/openvg.h686
-rw-r--r--include/VG/vgext.h233
-rw-r--r--include/VG/vgplatform.h106
-rw-r--r--include/VG/vgu.h130
-rw-r--r--progs/openvg/demos/Makefile40
-rw-r--r--progs/openvg/demos/gears.c394
-rw-r--r--progs/openvg/demos/lion-render.c1573
-rw-r--r--progs/openvg/demos/lion-render.h16
-rw-r--r--progs/openvg/demos/lion.c288
-rw-r--r--progs/openvg/demos/sp.c103
-rw-r--r--progs/openvg/trivial/Makefile127
-rw-r--r--progs/openvg/trivial/arc.c139
-rw-r--r--progs/openvg/trivial/cap.c75
-rw-r--r--progs/openvg/trivial/clear.c42
-rw-r--r--progs/openvg/trivial/coord.c66
-rw-r--r--progs/openvg/trivial/dash.c95
-rw-r--r--progs/openvg/trivial/eglcommon.c288
-rw-r--r--progs/openvg/trivial/eglcommon.h20
-rw-r--r--progs/openvg/trivial/ellipse.c84
-rw-r--r--progs/openvg/trivial/filter.c107
-rw-r--r--progs/openvg/trivial/gradorigin.c98
-rw-r--r--progs/openvg/trivial/lineto.c56
-rw-r--r--progs/openvg/trivial/lingrad.c87
-rw-r--r--progs/openvg/trivial/lookup.c71
-rw-r--r--progs/openvg/trivial/mask.c58
-rw-r--r--progs/openvg/trivial/mask4.c132
-rw-r--r--progs/openvg/trivial/path3.c77
-rw-r--r--progs/openvg/trivial/radialgrad.c99
-rw-r--r--progs/openvg/trivial/readpixels.c75
-rw-r--r--progs/openvg/trivial/roundedrect.c67
-rw-r--r--progs/openvg/trivial/star-nonzero.c55
-rw-r--r--progs/openvg/trivial/star-oddeven.c102
-rw-r--r--progs/openvg/trivial/stroke.c116
-rw-r--r--progs/openvg/trivial/stroke2.c207
-rw-r--r--progs/openvg/trivial/vguarc.c74
-rw-r--r--src/gallium/state_trackers/vega/Makefile128
-rw-r--r--src/gallium/state_trackers/vega/api_consts.h56
-rw-r--r--src/gallium/state_trackers/vega/api_context.c75
-rw-r--r--src/gallium/state_trackers/vega/api_filters.c805
-rw-r--r--src/gallium/state_trackers/vega/api_images.c489
-rw-r--r--src/gallium/state_trackers/vega/api_masks.c373
-rw-r--r--src/gallium/state_trackers/vega/api_misc.c83
-rw-r--r--src/gallium/state_trackers/vega/api_paint.c166
-rw-r--r--src/gallium/state_trackers/vega/api_params.c1673
-rw-r--r--src/gallium/state_trackers/vega/api_path.c488
-rw-r--r--src/gallium/state_trackers/vega/api_text.c258
-rw-r--r--src/gallium/state_trackers/vega/api_transform.c128
-rw-r--r--src/gallium/state_trackers/vega/arc.c708
-rw-r--r--src/gallium/state_trackers/vega/arc.h80
-rw-r--r--src/gallium/state_trackers/vega/asm_fill.h246
-rw-r--r--src/gallium/state_trackers/vega/asm_filters.h117
-rw-r--r--src/gallium/state_trackers/vega/asm_util.h136
-rw-r--r--src/gallium/state_trackers/vega/bezier.c704
-rw-r--r--src/gallium/state_trackers/vega/bezier.h81
-rw-r--r--src/gallium/state_trackers/vega/image.c654
-rw-r--r--src/gallium/state_trackers/vega/image.h104
-rw-r--r--src/gallium/state_trackers/vega/mask.c690
-rw-r--r--src/gallium/state_trackers/vega/mask.h68
-rw-r--r--src/gallium/state_trackers/vega/matrix.h462
-rw-r--r--src/gallium/state_trackers/vega/paint.c699
-rw-r--r--src/gallium/state_trackers/vega/paint.h118
-rw-r--r--src/gallium/state_trackers/vega/path.c2034
-rw-r--r--src/gallium/state_trackers/vega/path.h126
-rw-r--r--src/gallium/state_trackers/vega/path_utils.h109
-rw-r--r--src/gallium/state_trackers/vega/polygon.c550
-rw-r--r--src/gallium/state_trackers/vega/polygon.h75
-rw-r--r--src/gallium/state_trackers/vega/renderer.c592
-rw-r--r--src/gallium/state_trackers/vega/renderer.h76
-rw-r--r--src/gallium/state_trackers/vega/shader.c310
-rw-r--r--src/gallium/state_trackers/vega/shader.h56
-rw-r--r--src/gallium/state_trackers/vega/shaders_cache.c439
-rw-r--r--src/gallium/state_trackers/vega/shaders_cache.h77
-rw-r--r--src/gallium/state_trackers/vega/st_inlines.h159
-rw-r--r--src/gallium/state_trackers/vega/stroker.c1349
-rw-r--r--src/gallium/state_trackers/vega/stroker.h89
-rw-r--r--src/gallium/state_trackers/vega/util_array.h122
-rw-r--r--src/gallium/state_trackers/vega/vg_context.c543
-rw-r--r--src/gallium/state_trackers/vega/vg_context.h292
-rw-r--r--src/gallium/state_trackers/vega/vg_state.c124
-rw-r--r--src/gallium/state_trackers/vega/vg_state.h109
-rw-r--r--src/gallium/state_trackers/vega/vg_tracker.c406
-rw-r--r--src/gallium/state_trackers/vega/vg_tracker.h102
-rw-r--r--src/gallium/state_trackers/vega/vg_translate.c1030
-rw-r--r--src/gallium/state_trackers/vega/vg_translate.h49
-rw-r--r--src/gallium/state_trackers/vega/vgu.c450
86 files changed, 24891 insertions, 0 deletions
diff --git a/docs/openvg.html b/docs/openvg.html
new file mode 100644
index 00000000000..a8153b9db92
--- /dev/null
+++ b/docs/openvg.html
@@ -0,0 +1,48 @@
+<HTML>
+
+<TITLE>Mesa Release Notes</TITLE>
+
+<head><link rel="stylesheet" type="text/css" href="mesa.css"></head>
+
+<BODY>
+
+<body bgcolor="#eeeeee">
+
+<H1>OpenVG State Tracker</H1>
+
+<p>
+The current version of the OpenVG state tracker implements OpenVG 1.0.
+</p>
+<p>
+More informations about OpenVG can be found at <a href="http://www.khronos.org/openvg/">http://www.khronos.org/openvg/</a> .
+</p>
+<p>
+The OpenVG state tracker depends on the Gallium architecture and a working EGL implementation.
+</p>
+
+
+<h2>Building the library</h2>
+<ol>
+<li>Build Mesa3D with Gallium3D. Any build that builds Gallium3D libraries and EGL will suffice</li>
+<li>cd src/gallium/state_trackers/vega; make</li>
+<li>The last step will build libOpenVG library. You can add the libdir to LD_LIBRARY_PATH or install libOpenVG</li>
+</ol>
+
+<h3>Sample build</h3>
+A sample build looks as follows:
+<pre>
+make linux-x86-64-debug
+cd src/gallium/state_trackers/vega
+make
+cd ../../../..
+export LD_LIBRARY_PATH=$PWD/lib64
+export EGL_DRIVER="egl_softpipe"
+</pre>
+
+<h2>Notes</h2>
+<ul>
+<li>EGL_DRIVER environmental variable: forces usage of a specific EGL driver. Unless you force egl_softpipe the implementation will look for a DRI hardware accelerate driver and unless you have a Gallium driver that supports it, you'll see crashes</li>
+</ul>
+
+</body>
+</html>
diff --git a/include/VG/openvg.h b/include/VG/openvg.h
new file mode 100644
index 00000000000..60167e45d67
--- /dev/null
+++ b/include/VG/openvg.h
@@ -0,0 +1,686 @@
+/* $Revision: 6822 $ on $Date:: 2008-10-30 05:14:19 -0400 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * OpenVG 1.0.1 Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Materials.
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief OpenVG 1.0.1 API.
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _OPENVG_H
+#define _OPENVG_H
+
+#include <VG/vgplatform.h>
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#define OPENVG_VERSION_1_0 1
+#define OPENVG_VERSION_1_0_1 1
+
+#ifndef VG_MAXSHORT
+#define VG_MAXSHORT 0x7FFF
+#endif
+
+#ifndef VG_MAXINT
+#define VG_MAXINT 0x7FFFFFFF
+#endif
+
+#ifndef VG_MAX_ENUM
+#define VG_MAX_ENUM 0x7FFFFFFF
+#endif
+
+typedef long VGHandle;
+
+typedef VGHandle VGPath;
+typedef VGHandle VGImage;
+typedef VGHandle VGPaint;
+
+#define VG_INVALID_HANDLE ((VGHandle)0)
+
+typedef enum {
+ VG_FALSE = 0,
+ VG_TRUE = 1,
+
+ VG_BOOLEAN_FORCE_SIZE = VG_MAX_ENUM
+} VGboolean;
+
+typedef enum {
+ VG_NO_ERROR = 0,
+ VG_BAD_HANDLE_ERROR = 0x1000,
+ VG_ILLEGAL_ARGUMENT_ERROR = 0x1001,
+ VG_OUT_OF_MEMORY_ERROR = 0x1002,
+ VG_PATH_CAPABILITY_ERROR = 0x1003,
+ VG_UNSUPPORTED_IMAGE_FORMAT_ERROR = 0x1004,
+ VG_UNSUPPORTED_PATH_FORMAT_ERROR = 0x1005,
+ VG_IMAGE_IN_USE_ERROR = 0x1006,
+ VG_NO_CONTEXT_ERROR = 0x1007,
+
+ VG_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM
+} VGErrorCode;
+
+typedef enum {
+ /* Mode settings */
+ VG_MATRIX_MODE = 0x1100,
+ VG_FILL_RULE = 0x1101,
+ VG_IMAGE_QUALITY = 0x1102,
+ VG_RENDERING_QUALITY = 0x1103,
+ VG_BLEND_MODE = 0x1104,
+ VG_IMAGE_MODE = 0x1105,
+
+ /* Scissoring rectangles */
+ VG_SCISSOR_RECTS = 0x1106,
+
+ /* Stroke parameters */
+ VG_STROKE_LINE_WIDTH = 0x1110,
+ VG_STROKE_CAP_STYLE = 0x1111,
+ VG_STROKE_JOIN_STYLE = 0x1112,
+ VG_STROKE_MITER_LIMIT = 0x1113,
+ VG_STROKE_DASH_PATTERN = 0x1114,
+ VG_STROKE_DASH_PHASE = 0x1115,
+ VG_STROKE_DASH_PHASE_RESET = 0x1116,
+
+ /* Edge fill color for VG_TILE_FILL tiling mode */
+ VG_TILE_FILL_COLOR = 0x1120,
+
+ /* Color for vgClear */
+ VG_CLEAR_COLOR = 0x1121,
+
+ /* Enable/disable alpha masking and scissoring */
+ VG_MASKING = 0x1130,
+ VG_SCISSORING = 0x1131,
+
+ /* Pixel layout information */
+ VG_PIXEL_LAYOUT = 0x1140,
+ VG_SCREEN_LAYOUT = 0x1141,
+
+ /* Source format selection for image filters */
+ VG_FILTER_FORMAT_LINEAR = 0x1150,
+ VG_FILTER_FORMAT_PREMULTIPLIED = 0x1151,
+
+ /* Destination write enable mask for image filters */
+ VG_FILTER_CHANNEL_MASK = 0x1152,
+
+ /* Implementation limits (read-only) */
+ VG_MAX_SCISSOR_RECTS = 0x1160,
+ VG_MAX_DASH_COUNT = 0x1161,
+ VG_MAX_KERNEL_SIZE = 0x1162,
+ VG_MAX_SEPARABLE_KERNEL_SIZE = 0x1163,
+ VG_MAX_COLOR_RAMP_STOPS = 0x1164,
+ VG_MAX_IMAGE_WIDTH = 0x1165,
+ VG_MAX_IMAGE_HEIGHT = 0x1166,
+ VG_MAX_IMAGE_PIXELS = 0x1167,
+ VG_MAX_IMAGE_BYTES = 0x1168,
+ VG_MAX_FLOAT = 0x1169,
+ VG_MAX_GAUSSIAN_STD_DEVIATION = 0x116A,
+
+ VG_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
+} VGParamType;
+
+typedef enum {
+ VG_RENDERING_QUALITY_NONANTIALIASED = 0x1200,
+ VG_RENDERING_QUALITY_FASTER = 0x1201,
+ VG_RENDERING_QUALITY_BETTER = 0x1202, /* Default */
+
+ VG_RENDERING_QUALITY_FORCE_SIZE = VG_MAX_ENUM
+} VGRenderingQuality;
+
+typedef enum {
+ VG_PIXEL_LAYOUT_UNKNOWN = 0x1300,
+ VG_PIXEL_LAYOUT_RGB_VERTICAL = 0x1301,
+ VG_PIXEL_LAYOUT_BGR_VERTICAL = 0x1302,
+ VG_PIXEL_LAYOUT_RGB_HORIZONTAL = 0x1303,
+ VG_PIXEL_LAYOUT_BGR_HORIZONTAL = 0x1304,
+
+ VG_PIXEL_LAYOUT_FORCE_SIZE = VG_MAX_ENUM
+} VGPixelLayout;
+
+typedef enum {
+ VG_MATRIX_PATH_USER_TO_SURFACE = 0x1400,
+ VG_MATRIX_IMAGE_USER_TO_SURFACE = 0x1401,
+ VG_MATRIX_FILL_PAINT_TO_USER = 0x1402,
+ VG_MATRIX_STROKE_PAINT_TO_USER = 0x1403,
+
+ VG_MATRIX_MODE_FORCE_SIZE = VG_MAX_ENUM
+} VGMatrixMode;
+
+typedef enum {
+ VG_CLEAR_MASK = 0x1500,
+ VG_FILL_MASK = 0x1501,
+ VG_SET_MASK = 0x1502,
+ VG_UNION_MASK = 0x1503,
+ VG_INTERSECT_MASK = 0x1504,
+ VG_SUBTRACT_MASK = 0x1505,
+
+ VG_MASK_OPERATION_FORCE_SIZE = VG_MAX_ENUM
+} VGMaskOperation;
+
+#define VG_PATH_FORMAT_STANDARD 0
+
+typedef enum {
+ VG_PATH_DATATYPE_S_8 = 0,
+ VG_PATH_DATATYPE_S_16 = 1,
+ VG_PATH_DATATYPE_S_32 = 2,
+ VG_PATH_DATATYPE_F = 3,
+
+ VG_PATH_DATATYPE_FORCE_SIZE = VG_MAX_ENUM
+} VGPathDatatype;
+
+typedef enum {
+ VG_ABSOLUTE = 0,
+ VG_RELATIVE = 1,
+
+ VG_PATH_ABS_REL_FORCE_SIZE = VG_MAX_ENUM
+} VGPathAbsRel;
+
+typedef enum {
+ VG_CLOSE_PATH = ( 0 << 1),
+ VG_MOVE_TO = ( 1 << 1),
+ VG_LINE_TO = ( 2 << 1),
+ VG_HLINE_TO = ( 3 << 1),
+ VG_VLINE_TO = ( 4 << 1),
+ VG_QUAD_TO = ( 5 << 1),
+ VG_CUBIC_TO = ( 6 << 1),
+ VG_SQUAD_TO = ( 7 << 1),
+ VG_SCUBIC_TO = ( 8 << 1),
+ VG_SCCWARC_TO = ( 9 << 1),
+ VG_SCWARC_TO = (10 << 1),
+ VG_LCCWARC_TO = (11 << 1),
+ VG_LCWARC_TO = (12 << 1),
+
+ VG_PATH_SEGMENT_FORCE_SIZE = VG_MAX_ENUM
+} VGPathSegment;
+
+typedef enum {
+ VG_MOVE_TO_ABS = VG_MOVE_TO | VG_ABSOLUTE,
+ VG_MOVE_TO_REL = VG_MOVE_TO | VG_RELATIVE,
+ VG_LINE_TO_ABS = VG_LINE_TO | VG_ABSOLUTE,
+ VG_LINE_TO_REL = VG_LINE_TO | VG_RELATIVE,
+ VG_HLINE_TO_ABS = VG_HLINE_TO | VG_ABSOLUTE,
+ VG_HLINE_TO_REL = VG_HLINE_TO | VG_RELATIVE,
+ VG_VLINE_TO_ABS = VG_VLINE_TO | VG_ABSOLUTE,
+ VG_VLINE_TO_REL = VG_VLINE_TO | VG_RELATIVE,
+ VG_QUAD_TO_ABS = VG_QUAD_TO | VG_ABSOLUTE,
+ VG_QUAD_TO_REL = VG_QUAD_TO | VG_RELATIVE,
+ VG_CUBIC_TO_ABS = VG_CUBIC_TO | VG_ABSOLUTE,
+ VG_CUBIC_TO_REL = VG_CUBIC_TO | VG_RELATIVE,
+ VG_SQUAD_TO_ABS = VG_SQUAD_TO | VG_ABSOLUTE,
+ VG_SQUAD_TO_REL = VG_SQUAD_TO | VG_RELATIVE,
+ VG_SCUBIC_TO_ABS = VG_SCUBIC_TO | VG_ABSOLUTE,
+ VG_SCUBIC_TO_REL = VG_SCUBIC_TO | VG_RELATIVE,
+ VG_SCCWARC_TO_ABS = VG_SCCWARC_TO | VG_ABSOLUTE,
+ VG_SCCWARC_TO_REL = VG_SCCWARC_TO | VG_RELATIVE,
+ VG_SCWARC_TO_ABS = VG_SCWARC_TO | VG_ABSOLUTE,
+ VG_SCWARC_TO_REL = VG_SCWARC_TO | VG_RELATIVE,
+ VG_LCCWARC_TO_ABS = VG_LCCWARC_TO | VG_ABSOLUTE,
+ VG_LCCWARC_TO_REL = VG_LCCWARC_TO | VG_RELATIVE,
+ VG_LCWARC_TO_ABS = VG_LCWARC_TO | VG_ABSOLUTE,
+ VG_LCWARC_TO_REL = VG_LCWARC_TO | VG_RELATIVE,
+
+ VG_PATH_COMMAND_FORCE_SIZE = VG_MAX_ENUM
+} VGPathCommand;
+
+typedef enum {
+ VG_PATH_CAPABILITY_APPEND_FROM = (1 << 0),
+ VG_PATH_CAPABILITY_APPEND_TO = (1 << 1),
+ VG_PATH_CAPABILITY_MODIFY = (1 << 2),
+ VG_PATH_CAPABILITY_TRANSFORM_FROM = (1 << 3),
+ VG_PATH_CAPABILITY_TRANSFORM_TO = (1 << 4),
+ VG_PATH_CAPABILITY_INTERPOLATE_FROM = (1 << 5),
+ VG_PATH_CAPABILITY_INTERPOLATE_TO = (1 << 6),
+ VG_PATH_CAPABILITY_PATH_LENGTH = (1 << 7),
+ VG_PATH_CAPABILITY_POINT_ALONG_PATH = (1 << 8),
+ VG_PATH_CAPABILITY_TANGENT_ALONG_PATH = (1 << 9),
+ VG_PATH_CAPABILITY_PATH_BOUNDS = (1 << 10),
+ VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS = (1 << 11),
+ VG_PATH_CAPABILITY_ALL = (1 << 12) - 1,
+
+ VG_PATH_CAPABILITIES_FORCE_SIZE = VG_MAX_ENUM
+} VGPathCapabilities;
+
+typedef enum {
+ VG_PATH_FORMAT = 0x1600,
+ VG_PATH_DATATYPE = 0x1601,
+ VG_PATH_SCALE = 0x1602,
+ VG_PATH_BIAS = 0x1603,
+ VG_PATH_NUM_SEGMENTS = 0x1604,
+ VG_PATH_NUM_COORDS = 0x1605,
+
+ VG_PATH_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
+} VGPathParamType;
+
+typedef enum {
+ VG_CAP_BUTT = 0x1700,
+ VG_CAP_ROUND = 0x1701,
+ VG_CAP_SQUARE = 0x1702,
+
+ VG_CAP_STYLE_FORCE_SIZE = VG_MAX_ENUM
+} VGCapStyle;
+
+typedef enum {
+ VG_JOIN_MITER = 0x1800,
+ VG_JOIN_ROUND = 0x1801,
+ VG_JOIN_BEVEL = 0x1802,
+
+ VG_JOIN_STYLE_FORCE_SIZE = VG_MAX_ENUM
+} VGJoinStyle;
+
+typedef enum {
+ VG_EVEN_ODD = 0x1900,
+ VG_NON_ZERO = 0x1901,
+
+ VG_FILL_RULE_FORCE_SIZE = VG_MAX_ENUM
+} VGFillRule;
+
+typedef enum {
+ VG_STROKE_PATH = (1 << 0),
+ VG_FILL_PATH = (1 << 1),
+
+ VG_PAINT_MODE_FORCE_SIZE = VG_MAX_ENUM
+} VGPaintMode;
+
+typedef enum {
+ /* Color paint parameters */
+ VG_PAINT_TYPE = 0x1A00,
+ VG_PAINT_COLOR = 0x1A01,
+ VG_PAINT_COLOR_RAMP_SPREAD_MODE = 0x1A02,
+ VG_PAINT_COLOR_RAMP_PREMULTIPLIED = 0x1A07,
+ VG_PAINT_COLOR_RAMP_STOPS = 0x1A03,
+
+ /* Linear gradient paint parameters */
+ VG_PAINT_LINEAR_GRADIENT = 0x1A04,
+
+ /* Radial gradient paint parameters */
+ VG_PAINT_RADIAL_GRADIENT = 0x1A05,
+
+ /* Pattern paint parameters */
+ VG_PAINT_PATTERN_TILING_MODE = 0x1A06,
+
+ VG_PAINT_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
+} VGPaintParamType;
+
+typedef enum {
+ VG_PAINT_TYPE_COLOR = 0x1B00,
+ VG_PAINT_TYPE_LINEAR_GRADIENT = 0x1B01,
+ VG_PAINT_TYPE_RADIAL_GRADIENT = 0x1B02,
+ VG_PAINT_TYPE_PATTERN = 0x1B03,
+
+ VG_PAINT_TYPE_FORCE_SIZE = VG_MAX_ENUM
+} VGPaintType;
+
+typedef enum {
+ VG_COLOR_RAMP_SPREAD_PAD = 0x1C00,
+ VG_COLOR_RAMP_SPREAD_REPEAT = 0x1C01,
+ VG_COLOR_RAMP_SPREAD_REFLECT = 0x1C02,
+
+ VG_COLOR_RAMP_SPREAD_MODE_FORCE_SIZE = VG_MAX_ENUM
+} VGColorRampSpreadMode;
+
+typedef enum {
+ VG_TILE_FILL = 0x1D00,
+ VG_TILE_PAD = 0x1D01,
+ VG_TILE_REPEAT = 0x1D02,
+ VG_TILE_REFLECT = 0x1D03,
+
+ VG_TILING_MODE_FORCE_SIZE = VG_MAX_ENUM
+} VGTilingMode;
+
+typedef enum {
+ /* RGB{A,X} channel ordering */
+ VG_sRGBX_8888 = 0,
+ VG_sRGBA_8888 = 1,
+ VG_sRGBA_8888_PRE = 2,
+ VG_sRGB_565 = 3,
+ VG_sRGBA_5551 = 4,
+ VG_sRGBA_4444 = 5,
+ VG_sL_8 = 6,
+ VG_lRGBX_8888 = 7,
+ VG_lRGBA_8888 = 8,
+ VG_lRGBA_8888_PRE = 9,
+ VG_lL_8 = 10,
+ VG_A_8 = 11,
+ VG_BW_1 = 12,
+
+ /* {A,X}RGB channel ordering */
+ VG_sXRGB_8888 = 0 | (1 << 6),
+ VG_sARGB_8888 = 1 | (1 << 6),
+ VG_sARGB_8888_PRE = 2 | (1 << 6),
+ VG_sARGB_1555 = 4 | (1 << 6),
+ VG_sARGB_4444 = 5 | (1 << 6),
+ VG_lXRGB_8888 = 7 | (1 << 6),
+ VG_lARGB_8888 = 8 | (1 << 6),
+ VG_lARGB_8888_PRE = 9 | (1 << 6),
+
+ /* BGR{A,X} channel ordering */
+ VG_sBGRX_8888 = 0 | (1 << 7),
+ VG_sBGRA_8888 = 1 | (1 << 7),
+ VG_sBGRA_8888_PRE = 2 | (1 << 7),
+ VG_sBGR_565 = 3 | (1 << 7),
+ VG_sBGRA_5551 = 4 | (1 << 7),
+ VG_sBGRA_4444 = 5 | (1 << 7),
+ VG_lBGRX_8888 = 7 | (1 << 7),
+ VG_lBGRA_8888 = 8 | (1 << 7),
+ VG_lBGRA_8888_PRE = 9 | (1 << 7),
+
+ /* {A,X}BGR channel ordering */
+ VG_sXBGR_8888 = 0 | (1 << 6) | (1 << 7),
+ VG_sABGR_8888 = 1 | (1 << 6) | (1 << 7),
+ VG_sABGR_8888_PRE = 2 | (1 << 6) | (1 << 7),
+ VG_sABGR_1555 = 4 | (1 << 6) | (1 << 7),
+ VG_sABGR_4444 = 5 | (1 << 6) | (1 << 7),
+ VG_lXBGR_8888 = 7 | (1 << 6) | (1 << 7),
+ VG_lABGR_8888 = 8 | (1 << 6) | (1 << 7),
+ VG_lABGR_8888_PRE = 9 | (1 << 6) | (1 << 7),
+
+ VG_IMAGE_FORMAT_FORCE_SIZE = VG_MAX_ENUM
+} VGImageFormat;
+
+typedef enum {
+ VG_IMAGE_QUALITY_NONANTIALIASED = (1 << 0),
+ VG_IMAGE_QUALITY_FASTER = (1 << 1),
+ VG_IMAGE_QUALITY_BETTER = (1 << 2),
+
+ VG_IMAGE_QUALITY_FORCE_SIZE = VG_MAX_ENUM
+} VGImageQuality;
+
+typedef enum {
+ VG_IMAGE_FORMAT = 0x1E00,
+ VG_IMAGE_WIDTH = 0x1E01,
+ VG_IMAGE_HEIGHT = 0x1E02,
+
+ VG_IMAGE_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM
+} VGImageParamType;
+
+typedef enum {
+ VG_DRAW_IMAGE_NORMAL = 0x1F00,
+ VG_DRAW_IMAGE_MULTIPLY = 0x1F01,
+ VG_DRAW_IMAGE_STENCIL = 0x1F02,
+
+ VG_IMAGE_MODE_FORCE_SIZE = VG_MAX_ENUM
+} VGImageMode;
+
+typedef enum {
+ VG_RED = (1 << 3),
+ VG_GREEN = (1 << 2),
+ VG_BLUE = (1 << 1),
+ VG_ALPHA = (1 << 0),
+
+ VG_IMAGE_CHANNEL_FORCE_SIZE = VG_MAX_ENUM
+} VGImageChannel;
+
+typedef enum {
+ VG_BLEND_SRC = 0x2000,
+ VG_BLEND_SRC_OVER = 0x2001,
+ VG_BLEND_DST_OVER = 0x2002,
+ VG_BLEND_SRC_IN = 0x2003,
+ VG_BLEND_DST_IN = 0x2004,
+ VG_BLEND_MULTIPLY = 0x2005,
+ VG_BLEND_SCREEN = 0x2006,
+ VG_BLEND_DARKEN = 0x2007,
+ VG_BLEND_LIGHTEN = 0x2008,
+ VG_BLEND_ADDITIVE = 0x2009,
+
+ VG_BLEND_MODE_FORCE_SIZE = VG_MAX_ENUM
+} VGBlendMode;
+
+typedef enum {
+ VG_IMAGE_FORMAT_QUERY = 0x2100,
+ VG_PATH_DATATYPE_QUERY = 0x2101,
+
+ VG_HARDWARE_QUERY_TYPE_FORCE_SIZE = VG_MAX_ENUM
+} VGHardwareQueryType;
+
+typedef enum {
+ VG_HARDWARE_ACCELERATED = 0x2200,
+ VG_HARDWARE_UNACCELERATED = 0x2201,
+
+ VG_HARDWARE_QUERY_RESULT_FORCE_SIZE = VG_MAX_ENUM
+} VGHardwareQueryResult;
+
+typedef enum {
+ VG_VENDOR = 0x2300,
+ VG_RENDERER = 0x2301,
+ VG_VERSION = 0x2302,
+ VG_EXTENSIONS = 0x2303,
+
+ VG_STRING_ID_FORCE_SIZE = VG_MAX_ENUM
+} VGStringID;
+
+/* Function Prototypes */
+
+#ifndef VG_API_CALL
+# error VG_API_CALL must be defined
+#endif
+
+#ifndef VG_API_ENTRY
+# error VG_API_ENTRY must be defined
+#endif
+
+#ifndef VG_API_EXIT
+# error VG_API_EXIT must be defined
+#endif
+
+VG_API_CALL VGErrorCode VG_API_ENTRY vgGetError(void) VG_API_EXIT;
+
+VG_API_CALL void VG_API_ENTRY vgFlush(void) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgFinish(void) VG_API_EXIT;
+
+/* Getters and Setters */
+VG_API_CALL void VG_API_ENTRY vgSetf (VGParamType type, VGfloat value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSeti (VGParamType type, VGint value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetfv(VGParamType type, VGint count,
+ const VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetiv(VGParamType type, VGint count,
+ const VGint * values) VG_API_EXIT;
+
+VG_API_CALL VGfloat VG_API_ENTRY vgGetf(VGParamType type) VG_API_EXIT;
+VG_API_CALL VGint VG_API_ENTRY vgGeti(VGParamType type) VG_API_EXIT;
+VG_API_CALL VGint VG_API_ENTRY vgGetVectorSize(VGParamType type) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetfv(VGParamType type, VGint count, VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetiv(VGParamType type, VGint count, VGint * values) VG_API_EXIT;
+
+VG_API_CALL void VG_API_ENTRY vgSetParameterf(VGHandle object,
+ VGint paramType,
+ VGfloat value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetParameteri(VGHandle object,
+ VGint paramType,
+ VGint value) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetParameterfv(VGHandle object,
+ VGint paramType,
+ VGint count, const VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetParameteriv(VGHandle object,
+ VGint paramType,
+ VGint count, const VGint * values) VG_API_EXIT;
+
+VG_API_CALL VGfloat VG_API_ENTRY vgGetParameterf(VGHandle object,
+ VGint paramType) VG_API_EXIT;
+VG_API_CALL VGint VG_API_ENTRY vgGetParameteri(VGHandle object,
+ VGint paramType);
+VG_API_CALL VGint VG_API_ENTRY vgGetParameterVectorSize(VGHandle object,
+ VGint paramType) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetParameterfv(VGHandle object,
+ VGint paramType,
+ VGint count, VGfloat * values) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetParameteriv(VGHandle object,
+ VGint paramType,
+ VGint count, VGint * values) VG_API_EXIT;
+
+/* Matrix Manipulation */
+VG_API_CALL void VG_API_ENTRY vgLoadIdentity(void) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgLoadMatrix(const VGfloat * m) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetMatrix(VGfloat * m) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgMultMatrix(const VGfloat * m) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgTranslate(VGfloat tx, VGfloat ty) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgScale(VGfloat sx, VGfloat sy) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgShear(VGfloat shx, VGfloat shy) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgRotate(VGfloat angle) VG_API_EXIT;
+
+/* Masking and Clearing */
+VG_API_CALL void VG_API_ENTRY vgMask(VGImage mask, VGMaskOperation operation,
+ VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClear(VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+
+/* Paths */
+VG_API_CALL VGPath VG_API_ENTRY vgCreatePath(VGint pathFormat,
+ VGPathDatatype datatype,
+ VGfloat scale, VGfloat bias,
+ VGint segmentCapacityHint,
+ VGint coordCapacityHint,
+ VGbitfield capabilities) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClearPath(VGPath path, VGbitfield capabilities) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyPath(VGPath path) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgRemovePathCapabilities(VGPath path,
+ VGbitfield capabilities) VG_API_EXIT;
+VG_API_CALL VGbitfield VG_API_ENTRY vgGetPathCapabilities(VGPath path) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgAppendPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgAppendPathData(VGPath dstPath,
+ VGint numSegments,
+ const VGubyte * pathSegments,
+ const void * pathData) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgModifyPathCoords(VGPath dstPath, VGint startIndex,
+ VGint numSegments,
+ const void * pathData) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgTransformPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT;
+VG_API_CALL VGboolean VG_API_ENTRY vgInterpolatePath(VGPath dstPath,
+ VGPath startPath,
+ VGPath endPath,
+ VGfloat amount) VG_API_EXIT;
+VG_API_CALL VGfloat VG_API_ENTRY vgPathLength(VGPath path,
+ VGint startSegment, VGint numSegments) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPointAlongPath(VGPath path,
+ VGint startSegment, VGint numSegments,
+ VGfloat distance,
+ VGfloat * x, VGfloat * y,
+ VGfloat * tangentX, VGfloat * tangentY) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPathBounds(VGPath path,
+ VGfloat * minX, VGfloat * minY,
+ VGfloat * width, VGfloat * height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPathTransformedBounds(VGPath path,
+ VGfloat * minX, VGfloat * minY,
+ VGfloat * width, VGfloat * height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDrawPath(VGPath path, VGbitfield paintModes) VG_API_EXIT;
+
+/* Paint */
+VG_API_CALL VGPaint VG_API_ENTRY vgCreatePaint(void) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyPaint(VGPaint paint) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetPaint(VGPaint paint, VGbitfield paintModes) VG_API_EXIT;
+VG_API_CALL VGPaint VG_API_ENTRY vgGetPaint(VGPaintMode paintMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetColor(VGPaint paint, VGuint rgba) VG_API_EXIT;
+VG_API_CALL VGuint VG_API_ENTRY vgGetColor(VGPaint paint) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgPaintPattern(VGPaint paint, VGImage pattern) VG_API_EXIT;
+
+/* Images */
+VG_API_CALL VGImage VG_API_ENTRY vgCreateImage(VGImageFormat format,
+ VGint width, VGint height,
+ VGbitfield allowedQuality) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDestroyImage(VGImage image) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgClearImage(VGImage image,
+ VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgImageSubData(VGImage image,
+ const void * data, VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetImageSubData(VGImage image,
+ void * data, VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint x, VGint y,
+ VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL VGImage VG_API_ENTRY vgChildImage(VGImage parent,
+ VGint x, VGint y, VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL VGImage VG_API_ENTRY vgGetParent(VGImage image) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgCopyImage(VGImage dst, VGint dx, VGint dy,
+ VGImage src, VGint sx, VGint sy,
+ VGint width, VGint height,
+ VGboolean dither) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgDrawImage(VGImage image) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSetPixels(VGint dx, VGint dy,
+ VGImage src, VGint sx, VGint sy,
+ VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgWritePixels(const void * data, VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint dx, VGint dy,
+ VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGetPixels(VGImage dst, VGint dx, VGint dy,
+ VGint sx, VGint sy,
+ VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgReadPixels(void * data, VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint sx, VGint sy,
+ VGint width, VGint height) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgCopyPixels(VGint dx, VGint dy,
+ VGint sx, VGint sy,
+ VGint width, VGint height) VG_API_EXIT;
+
+/* Image Filters */
+VG_API_CALL void VG_API_ENTRY vgColorMatrix(VGImage dst, VGImage src,
+ const VGfloat * matrix) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgConvolve(VGImage dst, VGImage src,
+ VGint kernelWidth, VGint kernelHeight,
+ VGint shiftX, VGint shiftY,
+ const VGshort * kernel,
+ VGfloat scale,
+ VGfloat bias,
+ VGTilingMode tilingMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgSeparableConvolve(VGImage dst, VGImage src,
+ VGint kernelWidth,
+ VGint kernelHeight,
+ VGint shiftX, VGint shiftY,
+ const VGshort * kernelX,
+ const VGshort * kernelY,
+ VGfloat scale,
+ VGfloat bias,
+ VGTilingMode tilingMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgGaussianBlur(VGImage dst, VGImage src,
+ VGfloat stdDeviationX,
+ VGfloat stdDeviationY,
+ VGTilingMode tilingMode) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgLookup(VGImage dst, VGImage src,
+ const VGubyte * redLUT,
+ const VGubyte * greenLUT,
+ const VGubyte * blueLUT,
+ const VGubyte * alphaLUT,
+ VGboolean outputLinear,
+ VGboolean outputPremultiplied) VG_API_EXIT;
+VG_API_CALL void VG_API_ENTRY vgLookupSingle(VGImage dst, VGImage src,
+ const VGuint * lookupTable,
+ VGImageChannel sourceChannel,
+ VGboolean outputLinear,
+ VGboolean outputPremultiplied) VG_API_EXIT;
+
+/* Hardware Queries */
+VG_API_CALL VGHardwareQueryResult VG_API_ENTRY vgHardwareQuery(VGHardwareQueryType key,
+ VGint setting) VG_API_EXIT;
+
+/* Renderer and Extension Information */
+VG_API_CALL const VGubyte * VG_API_ENTRY vgGetString(VGStringID name) VG_API_EXIT;
+
+#ifdef __cplusplus
+} /* extern "C" */
+#endif
+
+#endif /* _OPENVG_H */
diff --git a/include/VG/vgext.h b/include/VG/vgext.h
new file mode 100644
index 00000000000..97e3e779e19
--- /dev/null
+++ b/include/VG/vgext.h
@@ -0,0 +1,233 @@
+/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * VG extensions Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Materials.
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief VG extensions
+ *//*-------------------------------------------------------------------*/
+
+
+
+#ifndef _VGEXT_H
+#define _VGEXT_H
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#include <VG/openvg.h>
+#include <VG/vgu.h>
+
+#ifndef VG_API_ENTRYP
+# define VG_API_ENTRYP VG_API_ENTRY*
+#endif
+
+#ifndef VGU_API_ENTRYP
+# define VGU_API_ENTRYP VGU_API_ENTRY*
+#endif
+
+/*-------------------------------------------------------------------------------
+ * KHR extensions
+ *------------------------------------------------------------------------------*/
+
+typedef enum {
+
+#ifndef VG_KHR_iterative_average_blur
+ VG_MAX_AVERAGE_BLUR_DIMENSION_KHR = 0x116B,
+ VG_AVERAGE_BLUR_DIMENSION_RESOLUTION_KHR = 0x116C,
+ VG_MAX_AVERAGE_BLUR_ITERATIONS_KHR = 0x116D,
+#endif
+
+ VG_PARAM_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
+} VGParamTypeKHR;
+
+#ifndef VG_KHR_EGL_image
+#define VG_KHR_EGL_image 1
+/* VGEGLImageKHR is an opaque handle to an EGLImage */
+typedef void* VGeglImageKHR;
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL VGImage VG_API_ENTRY vgCreateEGLImageTargetKHR(VGeglImageKHR image);
+#endif
+typedef VGImage (VG_API_ENTRYP PFNVGCREATEEGLIMAGETARGETKHRPROC) (VGeglImageKHR image);
+
+#endif
+
+
+#ifndef VG_KHR_iterative_average_blur
+#define VG_KHR_iterative_average_blur 1
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void vgIterativeAverageBlurKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
+#endif
+typedef void (VG_API_ENTRYP PFNVGITERATIVEAVERAGEBLURKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
+
+#endif
+
+
+#ifndef VG_KHR_advanced_blending
+#define VG_KHR_advanced_blending 1
+
+typedef enum {
+ VG_BLEND_OVERLAY_KHR = 0x2010,
+ VG_BLEND_HARDLIGHT_KHR = 0x2011,
+ VG_BLEND_SOFTLIGHT_SVG_KHR = 0x2012,
+ VG_BLEND_SOFTLIGHT_KHR = 0x2013,
+ VG_BLEND_COLORDODGE_KHR = 0x2014,
+ VG_BLEND_COLORBURN_KHR = 0x2015,
+ VG_BLEND_DIFFERENCE_KHR = 0x2016,
+ VG_BLEND_SUBTRACT_KHR = 0x2017,
+ VG_BLEND_INVERT_KHR = 0x2018,
+ VG_BLEND_EXCLUSION_KHR = 0x2019,
+ VG_BLEND_LINEARDODGE_KHR = 0x201a,
+ VG_BLEND_LINEARBURN_KHR = 0x201b,
+ VG_BLEND_VIVIDLIGHT_KHR = 0x201c,
+ VG_BLEND_LINEARLIGHT_KHR = 0x201d,
+ VG_BLEND_PINLIGHT_KHR = 0x201e,
+ VG_BLEND_HARDMIX_KHR = 0x201f,
+ VG_BLEND_CLEAR_KHR = 0x2020,
+ VG_BLEND_DST_KHR = 0x2021,
+ VG_BLEND_SRC_OUT_KHR = 0x2022,
+ VG_BLEND_DST_OUT_KHR = 0x2023,
+ VG_BLEND_SRC_ATOP_KHR = 0x2024,
+ VG_BLEND_DST_ATOP_KHR = 0x2025,
+ VG_BLEND_XOR_KHR = 0x2026,
+
+ VG_BLEND_MODE_KHR_FORCE_SIZE= VG_MAX_ENUM
+} VGBlendModeKHR;
+#endif
+
+#ifndef VG_KHR_parametric_filter
+#define VG_KHR_parametric_filter 1
+
+typedef enum {
+ VG_PF_OBJECT_VISIBLE_FLAG_KHR = (1 << 0),
+ VG_PF_KNOCKOUT_FLAG_KHR = (1 << 1),
+ VG_PF_OUTER_FLAG_KHR = (1 << 2),
+ VG_PF_INNER_FLAG_KHR = (1 << 3),
+
+ VG_PF_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
+} VGPfTypeKHR;
+
+typedef enum {
+ VGU_IMAGE_IN_USE_ERROR = 0xF010,
+
+ VGU_ERROR_CODE_KHR_FORCE_SIZE = VG_MAX_ENUM
+} VGUErrorCodeKHR;
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void VG_API_ENTRY vgParametricFilterKHR(VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguDropShadowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA) ;
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
+#endif
+typedef void (VG_API_ENTRYP PFNVGPARAMETRICFILTERKHRPROC) (VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUDROPSHADOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
+
+#endif
+
+
+/*-------------------------------------------------------------------------------
+ * NDS extensions
+ *------------------------------------------------------------------------------*/
+
+#ifndef VG_NDS_paint_generation
+#define VG_NDS_paint_generation 1
+
+typedef enum {
+ VG_PAINT_COLOR_RAMP_LINEAR_NDS = 0x1A10,
+ VG_COLOR_MATRIX_NDS = 0x1A11,
+ VG_PAINT_COLOR_TRANSFORM_LINEAR_NDS = 0x1A12,
+
+ VG_PAINT_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGPaintParamTypeNds;
+
+typedef enum {
+ VG_DRAW_IMAGE_COLOR_MATRIX_NDS = 0x1F10,
+
+ VG_IMAGE_MODE_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGImageModeNds;
+#endif
+
+
+#ifndef VG_NDS_projective_geometry
+#define VG_NDS_projective_geometry 1
+
+typedef enum {
+ VG_CLIP_MODE_NDS = 0x1180,
+ VG_CLIP_LINES_NDS = 0x1181,
+ VG_MAX_CLIP_LINES_NDS = 0x1182,
+
+ VG_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGParamTypeNds;
+
+typedef enum {
+ VG_CLIPMODE_NONE_NDS = 0x3000,
+ VG_CLIPMODE_CLIP_CLOSED_NDS = 0x3001,
+ VG_CLIPMODE_CLIP_OPEN_NDS = 0x3002,
+ VG_CLIPMODE_CULL_NDS = 0x3003,
+
+ VG_CLIPMODE_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGClipModeNds;
+
+typedef enum {
+ VG_RQUAD_TO_NDS = ( 13 << 1 ),
+ VG_RCUBIC_TO_NDS = ( 14 << 1 ),
+
+ VG_PATH_SEGMENT_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGPathSegmentNds;
+
+typedef enum {
+ VG_RQUAD_TO_ABS_NDS = (VG_RQUAD_TO_NDS | VG_ABSOLUTE),
+ VG_RQUAD_TO_REL_NDS = (VG_RQUAD_TO_NDS | VG_RELATIVE),
+ VG_RCUBIC_TO_ABS_NDS = (VG_RCUBIC_TO_NDS | VG_ABSOLUTE),
+ VG_RCUBIC_TO_REL_NDS = (VG_RCUBIC_TO_NDS | VG_RELATIVE),
+
+ VG_PATH_COMMAND_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGPathCommandNds;
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void VG_API_ENTRY vgProjectiveMatrixNDS(VGboolean enable) ;
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguTransformClipLineNDS(const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
+#endif
+typedef void (VG_API_ENTRYP PFNVGPROJECTIVEMATRIXNDSPROC) (VGboolean enable) ;
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUTRANSFORMCLIPLINENDSPROC) (const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
+
+#endif
+
+#ifdef __cplusplus
+} /* extern "C" */
+#endif
+
+#endif /* _VGEXT_H */
diff --git a/include/VG/vgplatform.h b/include/VG/vgplatform.h
new file mode 100644
index 00000000000..e4f269f6582
--- /dev/null
+++ b/include/VG/vgplatform.h
@@ -0,0 +1,106 @@
+/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * VG platform specific header Reference Implementation
+ * ----------------------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Materials.
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief VG platform specific header
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _VGPLATFORM_H
+#define _VGPLATFORM_H
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#ifndef VG_API_CALL
+#if defined(OPENVG_STATIC_LIBRARY)
+# define VG_API_CALL
+#else
+# if defined(_WIN32) || defined(__VC32__) /* Win32 */
+# if defined (OPENVG_DLL_EXPORTS)
+# define VG_API_CALL __declspec(dllexport)
+# else
+# define VG_API_CALL __declspec(dllimport)
+# endif
+# else
+# define VG_API_CALL extern
+# endif /* defined(_WIN32) ||... */
+#endif /* defined OPENVG_STATIC_LIBRARY */
+#endif /* ifndef VG_API_CALL */
+
+#ifndef VGU_API_CALL
+#if defined(OPENVG_STATIC_LIBRARY)
+# define VGU_API_CALL
+#else
+# if defined(_WIN32) || defined(__VC32__) /* Win32 */
+# if defined (OPENVG_DLL_EXPORTS)
+# define VGU_API_CALL __declspec(dllexport)
+# else
+# define VGU_API_CALL __declspec(dllimport)
+# endif
+# else
+# define VGU_API_CALL extern
+# endif /* defined(_WIN32) ||... */
+#endif /* defined OPENVG_STATIC_LIBRARY */
+#endif /* ifndef VGU_API_CALL */
+
+
+#ifndef VG_API_ENTRY
+#define VG_API_ENTRY
+#endif
+
+#ifndef VG_API_EXIT
+#define VG_API_EXIT
+#endif
+
+#ifndef VGU_API_ENTRY
+#define VGU_API_ENTRY
+#endif
+
+#ifndef VGU_API_EXIT
+#define VGU_API_EXIT
+#endif
+
+typedef float VGfloat;
+typedef signed char VGbyte;
+typedef unsigned char VGubyte;
+typedef signed short VGshort;
+typedef signed int VGint;
+typedef unsigned int VGuint;
+typedef unsigned int VGbitfield;
+
+#ifndef VG_VGEXT_PROTOTYPES
+#define VG_VGEXT_PROTOTYPES
+#endif
+
+#ifdef __cplusplus
+} /* extern "C" */
+#endif
+
+#endif /* _VGPLATFORM_H */
diff --git a/include/VG/vgu.h b/include/VG/vgu.h
new file mode 100644
index 00000000000..2799684e5e7
--- /dev/null
+++ b/include/VG/vgu.h
@@ -0,0 +1,130 @@
+/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * VGU 1.0.1 Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Materials.
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief VGU 1.0.1 API.
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _VGU_H
+#define _VGU_H
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#include <VG/openvg.h>
+
+#define VGU_VERSION_1_0 1
+
+#ifndef VGU_API_CALL
+# error VGU_API_CALL must be defined
+#endif
+
+#ifndef VGU_API_ENTRY
+# error VGU_API_ENTRY must be defined
+#endif
+
+#ifndef VGU_API_EXIT
+# error VGU_API_EXIT must be defined
+#endif
+
+
+typedef enum {
+ VGU_NO_ERROR = 0,
+ VGU_BAD_HANDLE_ERROR = 0xF000,
+ VGU_ILLEGAL_ARGUMENT_ERROR = 0xF001,
+ VGU_OUT_OF_MEMORY_ERROR = 0xF002,
+ VGU_PATH_CAPABILITY_ERROR = 0xF003,
+ VGU_BAD_WARP_ERROR = 0xF004,
+
+ VGU_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM
+} VGUErrorCode;
+
+typedef enum {
+ VGU_ARC_OPEN = 0xF100,
+ VGU_ARC_CHORD = 0xF101,
+ VGU_ARC_PIE = 0xF102,
+
+ VGU_ARC_TYPE_FORCE_SIZE = VG_MAX_ENUM
+} VGUArcType;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguLine(VGPath path,
+ VGfloat x0, VGfloat y0,
+ VGfloat x1, VGfloat y1) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguPolygon(VGPath path,
+ const VGfloat * points, VGint count,
+ VGboolean closed) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRect(VGPath path,
+ VGfloat x, VGfloat y,
+ VGfloat width, VGfloat height) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRoundRect(VGPath path,
+ VGfloat x, VGfloat y,
+ VGfloat width, VGfloat height,
+ VGfloat arcWidth, VGfloat arcHeight) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguEllipse(VGPath path,
+ VGfloat cx, VGfloat cy,
+ VGfloat width, VGfloat height) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguArc(VGPath path,
+ VGfloat x, VGfloat y,
+ VGfloat width, VGfloat height,
+ VGfloat startAngle, VGfloat angleExtent,
+ VGUArcType arcType) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToSquare(VGfloat sx0, VGfloat sy0,
+ VGfloat sx1, VGfloat sy1,
+ VGfloat sx2, VGfloat sy2,
+ VGfloat sx3, VGfloat sy3,
+ VGfloat * matrix) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpSquareToQuad(VGfloat dx0, VGfloat dy0,
+ VGfloat dx1, VGfloat dy1,
+ VGfloat dx2, VGfloat dy2,
+ VGfloat dx3, VGfloat dy3,
+ VGfloat * matrix) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToQuad(VGfloat dx0, VGfloat dy0,
+ VGfloat dx1, VGfloat dy1,
+ VGfloat dx2, VGfloat dy2,
+ VGfloat dx3, VGfloat dy3,
+ VGfloat sx0, VGfloat sy0,
+ VGfloat sx1, VGfloat sy1,
+ VGfloat sx2, VGfloat sy2,
+ VGfloat sx3, VGfloat sy3,
+ VGfloat * matrix) VGU_API_EXIT;
+
+#ifdef __cplusplus
+} /* extern "C" */
+#endif
+
+#endif /* #ifndef _VGU_H */
diff --git a/progs/openvg/demos/Makefile b/progs/openvg/demos/Makefile
new file mode 100644
index 00000000000..7ecb987f9d1
--- /dev/null
+++ b/progs/openvg/demos/Makefile
@@ -0,0 +1,40 @@
+# progs/vg/Makefile
+
+TOP = ../../..
+include $(TOP)/configs/current
+
+VG_LIBS=-lm -pthread -lEGL -lOpenVG
+INCLUDE_DIRS = -I$(TOP)/include
+
+PROGRAMS = \
+ gears \
+ lion
+
+.c.o:
+ $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@
+
+
+
+default: $(PROGRAMS)
+
+
+gears: gears.o
+ $(CC) $(CFLAGS) gears.o -L$(TOP)/$(LIB_DIR) $(VG_LIBS) -o $@
+
+gears.o: gears.c $(HEADERS)
+ $(CC) -c $(CFLAGS) -I$(TOP)/include gears.c
+
+
+lion: lion.o lion-render.o
+ $(CC) $(CFLAGS) lion.o lion-render.o -L$(TOP)/$(LIB_DIR) $(VG_LIBS) -o $@
+
+lion.o: lion.c lion-render.h $(HEADERS)
+ $(CC) -c $(CFLAGS) -I$(TOP)/include lion.c
+lion-render.o: lion-render.c lion-render.h $(HEADERS)
+ $(CC) -c $(CFLAGS) -I$(TOP)/include lion-render.c
+
+
+clean:
+ rm -f *.o *~
+ rm -f *.so
+ rm -f $(PROGRAMS)
diff --git a/progs/openvg/demos/gears.c b/progs/openvg/demos/gears.c
new file mode 100644
index 00000000000..7dcb3954a80
--- /dev/null
+++ b/progs/openvg/demos/gears.c
@@ -0,0 +1,394 @@
+#include <assert.h>
+#include <math.h>
+#include <stdlib.h>
+#include <stdio.h>
+#include <string.h>
+#include <X11/Xlib.h>
+#include <X11/Xutil.h>
+#include <X11/keysym.h>
+#include <VG/openvg.h>
+#include <GLES/egl.h>
+
+static VGint width, height;
+static VGPath gear1;
+static VGPath gear2;
+static VGPath gear3;
+
+static VGPaint fill;
+const VGfloat color[4] = {0.5, 0.5, 0.5, 1.0};
+
+static VGfloat gear1_angle = 35;
+static VGfloat gear2_angle = 24;
+static VGfloat gear3_angle = 33.5;
+
+static void moveTo(VGPath path, VGfloat x, VGfloat y)
+{
+ static VGubyte moveTo = VG_MOVE_TO | VG_ABSOLUTE;
+ VGfloat pathData[2];
+ pathData[0] = x; pathData[1] = y;
+ vgAppendPathData(path, 1, &moveTo, pathData);
+}
+
+static void lineTo(VGPath path, VGfloat x, VGfloat y)
+{
+ static VGubyte lineTo = VG_LINE_TO | VG_ABSOLUTE;
+ VGfloat pathData[2];
+ pathData[0] = x; pathData[1] = y;
+ vgAppendPathData(path, 1, &lineTo, pathData);
+}
+
+static void closeSubpath(VGPath path)
+{
+ static VGubyte close = VG_CLOSE_PATH | VG_ABSOLUTE;
+ VGfloat pathData[2];
+ vgAppendPathData(path, 1, &close, pathData);
+}
+
+static void cubicTo(VGPath path, VGfloat x1, VGfloat y1, VGfloat x2, VGfloat y2,
+ VGfloat midx, VGfloat midy)
+{
+ static VGubyte cubic = VG_CUBIC_TO | VG_ABSOLUTE;
+ VGfloat pathData[6];
+ pathData[0] = x1;
+ pathData[1] = y1;
+ pathData[2] = x2;
+ pathData[3] = y2;
+ pathData[4] = midx;
+ pathData[5] = midy;
+ vgAppendPathData(path, 1, &cubic, pathData);
+}
+
+static VGPath gearsPath(double inner_radius, double outer_radius,
+ int teeth, double tooth_depth)
+{
+ VGPath path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1.0f, 0.0f,
+ 0, 0, (unsigned int)VG_PATH_CAPABILITY_ALL);
+
+ int i;
+ double r0, r1, r2;
+ double angle, da;
+
+ r0 = inner_radius;
+ r1 = outer_radius - tooth_depth / 2.0;
+ r2 = outer_radius + tooth_depth / 2.0;
+
+ da = 2.0 * M_PI / (VGfloat) teeth / 4.0;
+
+ angle = 0.0;
+ moveTo(path, r1 * cos(angle + 3 * da), r1 * sin(angle + 3 * da));
+
+ for (i = 1; i <= teeth; i++) {
+ angle = i * 2.0 * M_PI / (VGfloat)teeth;
+
+ lineTo(path, r1 * cos(angle), r1 * sin(angle));
+ lineTo(path, r2 * cos(angle + da), r2 * sin(angle + da));
+ lineTo(path, r2 * cos(angle + 2 * da), r2 * sin(angle + 2 * da));
+
+ if (i < teeth)
+ lineTo(path, r1 * cos(angle + 3 * da),
+ r1 * sin(angle + 3 * da));
+ }
+
+ closeSubpath(path);
+
+ moveTo(path, r0 * cos(angle + 3 * da), r0 * sin(angle + 3 * da));
+
+ for (i = 1; i <= teeth; i++) {
+ angle = i * 2.0 * M_PI / (VGfloat) teeth;
+
+ lineTo(path, r0 * cos(angle), r0 * sin(angle));
+ }
+
+ closeSubpath(path);
+ return path;
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, width, height);
+
+ vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE);
+
+ vgLoadIdentity();
+ vgLoadIdentity();
+ vgTranslate(170, 330);
+ vgRotate(gear1_angle);
+ vgDrawPath(gear1, VG_FILL_PATH);
+
+ vgLoadIdentity();
+ vgTranslate(369, 330);
+ vgRotate(gear2_angle);
+ vgDrawPath(gear2, VG_FILL_PATH);
+
+ vgLoadIdentity();
+ vgTranslate(170, 116);
+ vgRotate(gear3_angle);
+ vgDrawPath(gear3, VG_FILL_PATH);
+
+ gear1_angle += 1;
+ gear2_angle -= (20.0 / 12.0);
+ gear3_angle -= (20.0 / 14.0);
+}
+
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ width = w;
+ height = h;
+}
+
+
+static void
+init(void)
+{
+ float clear_color[4] = {1.0, 1.0, 1.0, 1.0};
+ vgSetfv(VG_CLEAR_COLOR, 4, clear_color);
+
+ gear1 = gearsPath(30.0, 120.0, 20, 20.0);
+ gear2 = gearsPath(15.0, 75.0, 12, 20.0);
+ gear3 = gearsPath(20.0, 90.0, 14, 20.0);
+
+ fill = vgCreatePaint();
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color);
+ vgSetPaint(fill, VG_FILL_PATH);
+}
+
+
+/*
+ * Create an RGB, double-buffered X window.
+ * Return the window and context handles.
+ */
+static void
+make_x_window(Display *x_dpy, EGLDisplay egl_dpy,
+ const char *name,
+ int x, int y, int width, int height,
+ Window *winRet,
+ EGLContext *ctxRet,
+ EGLSurface *surfRet)
+{
+ static const EGLint attribs[] = {
+ EGL_RED_SIZE, 1,
+ EGL_GREEN_SIZE, 1,
+ EGL_BLUE_SIZE, 1,
+ EGL_NONE
+ };
+
+ int scrnum;
+ XSetWindowAttributes attr;
+ unsigned long mask;
+ Window root;
+ Window win;
+ XVisualInfo *visInfo, visTemplate;
+ int num_visuals;
+ EGLContext ctx;
+ EGLConfig config;
+ EGLint num_configs;
+ EGLint vid;
+
+ scrnum = DefaultScreen( x_dpy );
+ root = RootWindow( x_dpy, scrnum );
+
+ if (!eglChooseConfig( egl_dpy, attribs, &config, 1, &num_configs)) {
+ printf("Error: couldn't get an EGL visual config\n");
+ exit(1);
+ }
+
+ assert(config);
+ assert(num_configs > 0);
+
+ if (!eglGetConfigAttrib(egl_dpy, config, EGL_NATIVE_VISUAL_ID, &vid)) {
+ printf("Error: eglGetConfigAttrib() failed\n");
+ exit(1);
+ }
+
+ /* The X window visual must match the EGL config */
+ visTemplate.visualid = vid;
+ visInfo = XGetVisualInfo(x_dpy, VisualIDMask, &visTemplate, &num_visuals);
+ if (!visInfo) {
+ printf("Error: couldn't get X visual\n");
+ exit(1);
+ }
+
+ /* window attributes */
+ attr.background_pixel = 0;
+ attr.border_pixel = 0;
+ attr.colormap = XCreateColormap( x_dpy, root, visInfo->visual, AllocNone);
+ attr.event_mask = StructureNotifyMask | ExposureMask | KeyPressMask;
+ mask = CWBackPixel | CWBorderPixel | CWColormap | CWEventMask;
+
+ win = XCreateWindow( x_dpy, root, 0, 0, width, height,
+ 0, visInfo->depth, InputOutput,
+ visInfo->visual, mask, &attr );
+
+ /* set hints and properties */
+ {
+ XSizeHints sizehints;
+ sizehints.x = x;
+ sizehints.y = y;
+ sizehints.width = width;
+ sizehints.height = height;
+ sizehints.flags = USSize | USPosition;
+ XSetNormalHints(x_dpy, win, &sizehints);
+ XSetStandardProperties(x_dpy, win, name, name,
+ None, (char **)NULL, 0, &sizehints);
+ }
+
+ eglBindAPI(EGL_OPENVG_API);
+
+ ctx = eglCreateContext(egl_dpy, config, EGL_NO_CONTEXT, NULL );
+ if (!ctx) {
+ printf("Error: eglCreateContext failed\n");
+ exit(1);
+ }
+
+ *surfRet = eglCreateWindowSurface(egl_dpy, config, win, NULL);
+
+ if (!*surfRet) {
+ printf("Error: eglCreateWindowSurface failed\n");
+ exit(1);
+ }
+
+ XFree(visInfo);
+
+ *winRet = win;
+ *ctxRet = ctx;
+}
+
+
+static void
+event_loop(Display *dpy, Window win,
+ EGLDisplay egl_dpy, EGLSurface egl_surf)
+{
+ while (1) {
+ XEvent event;
+
+ while (XPending(dpy) > 0) {
+ XNextEvent(dpy, &event);
+
+ switch (event.type) {
+ case Expose:
+ break;
+ case ConfigureNotify:
+ reshape(event.xconfigure.width, event.xconfigure.height);
+ break;
+ case KeyPress:
+ {
+ char buffer[10];
+ int r, code;
+ code = XLookupKeysym(&event.xkey, 0);
+ r = XLookupString(&event.xkey, buffer, sizeof(buffer),
+ NULL, NULL);
+ if (buffer[0] == 27) {
+ /* escape */
+ return;
+ }
+ }
+ break;
+ default:
+ ; /*no-op*/
+ }
+ }
+
+ draw();
+ eglSwapBuffers(egl_dpy, egl_surf);
+ }
+}
+
+
+static void
+usage(void)
+{
+ printf("Usage:\n");
+ printf(" -display <displayname> set the display to run on\n");
+ printf(" -info display OpenGL renderer info\n");
+}
+
+int
+main(int argc, char *argv[])
+{
+ const int winWidth = 500, winHeight = 500;
+ Display *x_dpy;
+ Window win;
+ EGLSurface egl_surf;
+ EGLContext egl_ctx;
+ EGLDisplay egl_dpy;
+ char *dpyName = NULL;
+ GLboolean printInfo = GL_FALSE;
+ EGLint egl_major, egl_minor;
+ int i;
+ const char *s;
+
+ for (i = 1; i < argc; i++) {
+ if (strcmp(argv[i], "-display") == 0) {
+ dpyName = argv[i+1];
+ i++;
+ }
+ else if (strcmp(argv[i], "-info") == 0) {
+ printInfo = GL_TRUE;
+ }
+ else {
+ usage();
+ return -1;
+ }
+ }
+
+ x_dpy = XOpenDisplay(dpyName);
+ if (!x_dpy) {
+ printf("Error: couldn't open display %s\n",
+ dpyName ? dpyName : getenv("DISPLAY"));
+ return -1;
+ }
+
+ egl_dpy = eglGetDisplay(x_dpy);
+ if (!egl_dpy) {
+ printf("Error: eglGetDisplay() failed\n");
+ return -1;
+ }
+
+ if (!eglInitialize(egl_dpy, &egl_major, &egl_minor)) {
+ printf("Error: eglInitialize() failed\n");
+ return -1;
+ }
+
+ s = eglQueryString(egl_dpy, EGL_VERSION);
+ printf("EGL_VERSION = %s\n", s);
+
+ make_x_window(x_dpy, egl_dpy,
+ "xegl_tri", 0, 0, winWidth, winHeight,
+ &win, &egl_ctx, &egl_surf);
+
+ XMapWindow(x_dpy, win);
+ if (!eglMakeCurrent(egl_dpy, egl_surf, egl_surf, egl_ctx)) {
+ printf("Error: eglMakeCurrent() failed\n");
+ return -1;
+ }
+
+ if (printInfo) {
+ printf("VG_RENDERER = %s\n", (char *) vgGetString(VG_RENDERER));
+ printf("VG_VERSION = %s\n", (char *) vgGetString(VG_VERSION));
+ printf("VG_VENDOR = %s\n", (char *) vgGetString(VG_VENDOR));
+ }
+
+ init();
+
+ /* Set initial projection/viewing transformation.
+ * We can't be sure we'll get a ConfigureNotify event when the window
+ * first appears.
+ */
+ reshape(winWidth, winHeight);
+
+ event_loop(x_dpy, win, egl_dpy, egl_surf);
+
+ eglDestroyContext(egl_dpy, egl_ctx);
+ eglDestroySurface(egl_dpy, egl_surf);
+ eglTerminate(egl_dpy);
+
+
+ XDestroyWindow(x_dpy, win);
+ XCloseDisplay(x_dpy);
+
+ return 0;
+}
diff --git a/progs/openvg/demos/lion-render.c b/progs/openvg/demos/lion-render.c
new file mode 100644
index 00000000000..f3f151f5522
--- /dev/null
+++ b/progs/openvg/demos/lion-render.c
@@ -0,0 +1,1573 @@
+#include "lion-render.h"
+
+#include <stdlib.h>
+#include <stdio.h>
+
+#define ELEMENTS(x) (sizeof(x)/sizeof((x)[0]))
+
+static void init(struct lion *l, int i, VGint hexColor, const VGfloat *coords, int elems)
+{
+ static VGubyte cmds[128];
+ VGfloat color[4];
+ VGint j;
+
+ color[0] = ((hexColor >> 16) & 0xff) / 255.f;
+ color[1] = ((hexColor >> 8) & 0xff) / 255.f;
+ color[2] = ((hexColor >> 0) & 0xff) / 255.f;
+ color[3] = 1.0;
+
+ l->paths[i] = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1.0f, 0.0f,
+ 0, 0, (unsigned int)VG_PATH_CAPABILITY_ALL);
+ l->fills[i] = vgCreatePaint();
+ vgSetParameterfv(l->fills[i], VG_PAINT_COLOR, 4, color);
+
+ cmds[0] = VG_MOVE_TO_ABS;
+ for (j = 1; j < elems; ++j) {
+ cmds[j] = VG_LINE_TO_ABS;
+ }
+
+ vgAppendPathData(l->paths[i], elems, cmds, coords);
+}
+
+static void poly0(struct lion *l)
+{
+ VGfloat color = 0xf2cc99;
+ static const VGfloat coords[] = {69,18, 82,8, 99,3, 118,5, 135,12, 149,21, 156,13, 165,9, 177,13, 183,28,
+ 180,50, 164,91, 155,107, 154,114, 151,121, 141,127, 139,136, 155,206, 157,251, 126,342,
+ 133,357, 128,376, 83,376, 75,368, 67,350, 61,350, 53,369, 4,369, 2,361, 5,354,
+ 12,342, 16,321, 4,257, 4,244, 7,218, 9,179, 26,127, 43,93, 32,77, 30,70,
+ 24,67, 16,49, 17,35, 18,23, 30,12, 40,7, 53,7, 62,12
+ };
+
+ init(l, 0, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly1(struct lion *l)
+{
+ VGfloat color = 0xe5b27f;
+ static const VGfloat coords[] = {142,79, 136,74, 138,82, 133,78, 133,84, 127,78, 128,85,
+ 124,80, 125,87, 119,82, 119,90, 125,99, 125,96, 128,100, 128,94,
+ 131,98, 132,93, 135,97, 136,93, 138,97, 139,94, 141,98, 143,94,
+ 144,85
+ };
+
+ init(l, 1, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly2(struct lion *l)
+{
+ VGfloat color = 0xeb8080;
+ static const VGfloat coords[] = {127,101, 132,100, 137,99, 144,101, 143,105, 135,110
+ };
+
+ init(l, 2, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly3(struct lion *l)
+{
+ VGfloat color = 0xf2cc99;
+ static const VGfloat coords[] = {178,229, 157,248, 139,296, 126,349, 137,356,
+ 158,357, 183,342, 212,332, 235,288, 235,261,
+ 228,252, 212,250, 188,251
+ };
+
+ init(l, 3, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly4(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {56,229, 48,241, 48,250, 57,281, 63,325, 71,338,
+ 81,315, 76,321, 79,311, 83,301, 75,308, 80,298,
+ 73,303, 76,296, 71,298, 74,292, 69,293, 74,284,
+ 78,278, 71,278, 74,274, 68,273, 70,268, 66,267,
+ 68,261, 60,266, 62,259, 65,253, 57,258, 59,251,
+ 55,254, 55,248, 60,237, 54,240, 58,234, 54,236
+ };
+
+ init(l, 4, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly5(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {74,363, 79,368, 81,368, 85,362, 89,363, 92,370, 96,373,
+ 101,372, 108,361, 110,371, 113,373, 116,371, 120,358, 122,363,
+ 123,371, 126,371, 129,367, 132,357, 135,361, 130,376, 127,377,
+ 94,378, 84,376, 76,371
+ };
+
+ init(l, 5, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly6(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {212,250, 219,251, 228,258, 236,270, 235,287, 225,304,
+ 205,332, 177,343, 171,352, 158,357, 166,352, 168,346,
+ 168,339, 165,333, 155,327, 155,323, 161,320, 165,316,
+ 169,316, 167,312, 171,313, 168,308, 173,309, 170,306,
+ 177,306, 175,308, 177,311, 174,311, 176,316, 171,315,
+ 174,319, 168,320, 168,323, 175,327, 179,332, 183,326,
+ 184,332, 189,323, 190,328, 194,320, 194,325, 199,316,
+ 201,320, 204,313, 206,316, 208,310, 211,305, 219,298,
+ 226,288, 229,279, 228,266, 224,259, 217,253
+ };
+
+ init(l, 6, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly7(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {151,205, 151,238, 149,252, 141,268, 128,282, 121,301,
+ 130,300, 126,313, 118,324, 116,337, 120,346, 133,352,
+ 133,340, 137,333, 145,329, 156,327, 153,319, 153,291,
+ 157,271, 170,259, 178,277, 193,250, 174,216
+ };
+
+ init(l, 7, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly8(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {78,127, 90,142, 95,155, 108,164, 125,167, 139,175,
+ 150,206, 152,191, 141,140, 121,148, 100,136
+ };
+
+ init(l, 8, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly9(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {21,58, 35,63, 38,68, 32,69, 42,74, 40,79, 47,80, 54,83,
+ 45,94, 34,81, 32,73, 24,66
+ };
+
+ init(l, 9, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly10(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {71,34, 67,34, 66,27, 59,24, 54,17, 48,17, 39,22,
+ 30,26, 28,31, 31,39, 38,46, 29,45, 36,54, 41,61,
+ 41,70, 50,69, 54,71, 55,58, 67,52, 76,43, 76,39,
+ 68,44
+ };
+
+ init(l, 10, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly11(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {139,74, 141,83, 143,89, 144,104, 148,104, 155,106,
+ 154,86, 157,77, 155,72, 150,77, 144,77
+ };
+
+ init(l, 11, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly12(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {105,44, 102,53, 108,58, 111,62, 112,55
+ };
+
+ init(l, 12, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly13(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {141,48, 141,54, 144,58, 139,62, 137,66, 136,59, 137,52
+ };
+
+ init(l, 13, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly14(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {98,135, 104,130, 105,134, 108,132, 108,135, 112,134,
+ 113,137, 116,136, 116,139, 119,139, 124,141, 128,140,
+ 133,138, 140,133, 139,140, 126,146, 104,144
+ };
+
+ init(l, 14, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly15(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {97,116, 103,119, 103,116, 111,118, 116,117, 122,114,
+ 127,107, 135,111, 142,107, 141,114, 145,118, 149,121,
+ 145,125, 140,124, 127,121, 113,125, 100,124
+ };
+
+ init(l, 15, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly16(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {147,33, 152,35, 157,34, 153,31, 160,31, 156,28, 161,28,
+ 159,24, 163,25, 163,21, 165,22, 170,23, 167,17, 172,21,
+ 174,18, 175,23, 176,22, 177,28, 177,33, 174,37, 176,39,
+ 174,44, 171,49, 168,53, 164,57, 159,68, 156,70, 154,60,
+ 150,51, 146,43, 144,35
+ };
+
+ init(l, 16, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly17(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {85,72, 89,74, 93,75, 100,76, 105,75, 102,79, 94,79, 88,76
+ };
+
+ init(l, 17, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly18(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {86,214, 79,221, 76,232, 82,225, 78,239, 82,234, 78,245,
+ 81,243, 79,255, 84,250, 84,267, 87,254, 90,271, 90,257,
+ 95,271, 93,256, 95,249, 92,252, 93,243, 89,253, 89,241,
+ 86,250, 87,236, 83,245, 87,231, 82,231, 90,219, 84,221
+ };
+
+ init(l, 18, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly19(struct lion *l)
+{
+ VGfloat color = 0xffcc7f;
+ static const VGfloat coords[] = {93,68, 96,72, 100,73, 106,72, 108,66, 105,63, 100,62
+ };
+
+ init(l, 19, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly20(struct lion *l)
+{
+ VGfloat color = 0xffcc7f;
+ static const VGfloat coords[] = {144,64, 142,68, 142,73, 146,74, 150,73, 154,64, 149,62
+ };
+
+ init(l, 20, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly21(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {57,91, 42,111, 52,105, 41,117, 53,112, 46,120, 53,116,
+ 50,124, 57,119, 55,127, 61,122, 60,130, 67,126, 66,134,
+ 71,129, 72,136, 77,130, 76,137, 80,133, 82,138, 86,135,
+ 96,135, 94,129, 86,124, 83,117, 77,123, 79,117, 73,120,
+ 75,112, 68,116, 71,111, 65,114, 69,107, 63,110, 68,102,
+ 61,107, 66,98, 61,103, 63,97, 57,99
+ };
+
+ init(l, 21, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly22(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {83,79, 76,79, 67,82, 75,83, 65,88, 76,87, 65,92, 76,91,
+ 68,96, 77,95, 70,99, 80,98, 72,104, 80,102, 76,108, 85,103,
+ 92,101, 87,98, 93,96, 86,94, 91,93, 85,91, 93,89, 99,89, 105,93,
+ 107,85, 102,82, 92,80
+ };
+
+ init(l, 22, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly23(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {109,77, 111,83, 109,89, 113,94, 117,90, 117,81, 114,78
+ };
+
+ init(l, 23, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly24(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {122,128, 127,126, 134,127, 136,129, 134,130, 130,128, 124,129
+ };
+
+ init(l, 24, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly25(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {78,27, 82,32, 80,33, 82,36, 78,37, 82,40, 78,42, 81,46, 76,47,
+ 78,49, 74,50, 82,52, 87,50, 83,48, 91,46, 86,45, 91,42, 88,40,
+ 92,37, 86,34, 90,31, 86,29, 89,26
+ };
+
+ init(l, 25, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly26(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {82,17, 92,20, 79,21, 90,25, 81,25, 94,28, 93,26, 101,30,
+ 101,26, 107,33, 108,28, 111,40, 113,34, 115,45, 117,39,
+ 119,54, 121,46, 124,58, 126,47, 129,59, 130,49, 134,58,
+ 133,44, 137,48, 133,37, 137,40, 133,32, 126,20, 135,26,
+ 132,19, 138,23, 135,17, 142,18, 132,11, 116,6, 94,6, 78,11,
+ 92,12, 80,14, 90,16
+ };
+
+ init(l, 26, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly27(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {142,234, 132,227, 124,223, 115,220, 110,225, 118,224, 127,229,
+ 135,236, 122,234, 115,237, 113,242, 121,238, 139,243, 121,245,
+ 111,254, 95,254, 102,244, 104,235, 110,229, 100,231, 104,224,
+ 113,216, 122,215, 132,217, 141,224, 145,230, 149,240
+ };
+
+ init(l, 27, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly28(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {115,252, 125,248, 137,249, 143,258, 134,255, 125,254
+ };
+
+ init(l, 28, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly29(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {114,212, 130,213, 140,219, 147,225, 144,214, 137,209, 128,207
+ };
+
+ init(l, 29, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly30(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {102,263, 108,258, 117,257, 131,258, 116,260, 109,265
+ };
+
+ init(l, 30, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly31(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {51,241, 35,224, 40,238, 23,224, 31,242, 19,239, 28,247, 17,246,
+ 25,250, 37,254, 39,263, 44,271, 47,294, 48,317, 51,328, 60,351,
+ 60,323, 53,262, 47,246
+ };
+
+ init(l, 31, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly32(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {2,364, 9,367, 14,366, 18,355, 20,364, 26,366, 31,357, 35,364,
+ 39,364, 42,357, 47,363, 53,360, 59,357, 54,369, 7,373
+ };
+
+ init(l, 32, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly33(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {7,349, 19,345, 25,339, 18,341, 23,333, 28,326, 23,326, 27,320,
+ 23,316, 25,311, 20,298, 15,277, 12,264, 9,249, 10,223, 3,248,
+ 5,261, 15,307, 17,326, 11,343
+ };
+
+ init(l, 33, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly34(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {11,226, 15,231, 25,236, 18,227
+ };
+
+ init(l, 34, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly35(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {13,214, 19,217, 32,227, 23,214, 16,208, 15,190, 24,148,
+ 31,121, 24,137, 14,170, 8,189
+ };
+
+ init(l, 35, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly36(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {202,254, 195,258, 199,260, 193,263, 197,263, 190,268,
+ 196,268, 191,273, 188,282, 200,272, 194,272, 201,266,
+ 197,265, 204,262, 200,258, 204,256
+ };
+
+ init(l, 36, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly37(struct lion *l)
+{
+ VGfloat color = 0x845433;
+ static const VGfloat coords[] = {151,213, 165,212, 179,225, 189,246, 187,262, 179,275,
+ 176,263, 177,247, 171,233, 163,230, 165,251, 157,264,
+ 146,298, 145,321, 133,326, 143,285, 154,260, 153,240
+ };
+
+ init(l, 37, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly38(struct lion *l)
+{
+ VGfloat color = 0x845433;
+ static const VGfloat coords[] = {91,132, 95,145, 97,154, 104,148, 107,155, 109,150, 111,158,
+ 115,152, 118,159, 120,153, 125,161, 126,155, 133,164, 132,154,
+ 137,163, 137,152, 142,163, 147,186, 152,192, 148,167, 141,143,
+ 124,145, 105,143
+ };
+
+ init(l, 38, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly39(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {31,57, 23,52, 26,51, 20,44, 23,42, 21,36, 22,29, 25,23,
+ 24,32, 30,43, 26,41, 30,50, 26,48
+ };
+
+ init(l, 39, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly40(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {147,21, 149,28, 155,21, 161,16, 167,14, 175,15, 173,11, 161,9
+ };
+
+ init(l, 40, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly41(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {181,39, 175,51, 169,57, 171,65, 165,68, 165,75, 160,76,
+ 162,91, 171,71, 180,51
+ };
+
+ init(l, 41, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly42(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {132,346, 139,348, 141,346, 142,341, 147,342, 143,355, 133,350
+ };
+
+ init(l, 42, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly43(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {146,355, 151,352, 155,348, 157,343, 160,349, 151,356, 147,357
+ };
+
+ init(l, 43, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly44(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {99,266, 100,281, 94,305, 86,322, 78,332, 72,346, 73,331, 91,291
+ };
+
+ init(l, 44, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly45(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {20,347, 32,342, 45,340, 54,345, 45,350, 42,353, 38,350,
+ 31,353, 29,356, 23,350, 19,353, 15,349
+ };
+
+ init(l, 45, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly46(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {78,344, 86,344, 92,349, 88,358, 84,352
+ };
+
+ init(l, 46, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly47(struct lion *l)
+{
+ VGfloat color = 0x9c826b;
+ static const VGfloat coords[] = {93,347, 104,344, 117,345, 124,354, 121,357, 116,351,
+ 112,351, 108,355, 102,351
+ };
+
+ init(l, 47, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly48(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {105,12, 111,18, 113,24, 113,29, 119,34, 116,23, 112,16
+ };
+
+ init(l, 48, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly49(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {122,27, 125,34, 127,43, 128,34, 125,29
+ };
+
+ init(l, 49, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly50(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {115,13, 122,19, 122,15, 113,10
+ };
+
+ init(l, 50, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly51(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {116,172, 107,182, 98,193, 98,183, 90,199, 89,189, 84,207,
+ 88,206, 87,215, 95,206, 93,219, 91,230, 98,216, 97,226,
+ 104,214, 112,209, 104,208, 113,202, 126,200, 139,207, 132,198,
+ 142,203, 134,192, 142,195, 134,187, 140,185, 130,181, 136,177,
+ 126,177, 125,171, 116,180
+ };
+
+ init(l, 51, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly52(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {74,220, 67,230, 67,221, 59,235, 63,233, 60,248, 70,232, 65,249,
+ 71,243, 67,256, 73,250, 69,262, 73,259, 71,267, 76,262, 72,271,
+ 78,270, 76,275, 82,274, 78,290, 86,279, 86,289, 92,274, 88,275,
+ 87,264, 82,270, 82,258, 77,257, 78,247, 73,246, 77,233, 72,236
+ };
+
+ init(l, 52, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly53(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {133,230, 147,242, 148,250, 145,254, 138,247, 129,246, 142,245,
+ 138,241, 128,237, 137,238
+ };
+
+ init(l, 53, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly54(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {133,261, 125,261, 116,263, 111,267, 125,265
+ };
+
+ init(l, 54, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly55(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {121,271, 109,273, 103,279, 99,305, 92,316, 85,327, 83,335,
+ 89,340, 97,341, 94,336, 101,336, 96,331, 103,330, 97,327, 108,325,
+ 99,322, 109,321, 100,318, 110,317, 105,314, 110,312, 107,310, 113,308,
+ 105,306, 114,303, 105,301, 115,298, 107,295, 115,294, 108,293, 117,291,
+ 109,289, 117,286, 109,286, 118,283, 112,281, 118,279, 114,278,
+ 119,276, 115,274
+ };
+
+ init(l, 55, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly56(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {79,364, 74,359, 74,353, 76,347, 80,351, 83,356, 82,360
+ };
+
+ init(l, 56, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly57(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {91,363, 93,356, 97,353, 103,355, 105,360, 103,366, 99,371, 94,368
+ };
+
+ init(l, 57, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly58(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {110,355, 114,353, 118,357, 117,363, 113,369, 111,362
+ };
+
+ init(l, 58, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly59(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {126,354, 123,358, 124,367, 126,369, 129,361, 129,357
+ };
+
+ init(l, 59, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly60(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {30,154, 24,166, 20,182, 23,194, 29,208, 37,218, 41,210, 41,223,
+ 46,214, 46,227, 52,216, 52,227, 61,216, 59,225, 68,213, 73,219,
+ 70,207, 77,212, 69,200, 77,202, 70,194, 78,197, 68,187, 76,182,
+ 64,182, 58,175, 58,185, 53,177, 50,186, 46,171, 44,182, 39,167,
+ 36,172, 36,162, 30,166
+ };
+
+ init(l, 60, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly61(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {44,130, 41,137, 45,136, 43,150, 48,142, 48,157, 53,150,
+ 52,164, 60,156, 61,169, 64,165, 66,175, 70,167, 74,176,
+ 77,168, 80,183, 85,172, 90,182, 93,174, 98,181, 99,173,
+ 104,175, 105,169, 114,168, 102,163, 95,157, 94,166, 90,154,
+ 87,162, 82,149, 75,159, 72,148, 68,155, 67,143, 62,148, 62,138,
+ 58,145, 56,133, 52,142, 52,128, 49,134, 47,125
+ };
+
+ init(l, 61, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly62(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {13,216, 19,219, 36,231, 22,223, 16,222, 22,227, 12,224, 13,220, 16,220
+ };
+
+ init(l, 62, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly63(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {10,231, 14,236, 25,239, 27,237, 19,234
+ };
+
+ init(l, 63, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly64(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {9,245, 14,242, 25,245, 13,245
+ };
+
+ init(l, 64, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly65(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {33,255, 26,253, 18,254, 25,256, 18,258, 27,260, 18,263,
+ 27,265, 19,267, 29,270, 21,272, 29,276, 21,278, 30,281,
+ 22,283, 31,287, 24,288, 32,292, 23,293, 34,298, 26,299,
+ 37,303, 32,305, 39,309, 33,309, 39,314, 34,314, 40,318,
+ 34,317, 40,321, 34,321, 41,326, 33,326, 40,330, 33,332,
+ 39,333, 33,337, 42,337, 54,341, 49,337, 52,335, 47,330,
+ 50,330, 45,325, 49,325, 45,321, 48,321, 45,316, 46,306,
+ 45,286, 43,274, 36,261
+ };
+
+ init(l, 65, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly66(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {7,358, 9,351, 14,351, 17,359, 11,364
+ };
+
+ init(l, 66, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly67(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {44,354, 49,351, 52,355, 49,361
+ };
+
+ init(l, 67, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly68(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {32,357, 37,353, 40,358, 36,361
+ };
+
+ init(l, 68, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly69(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {139,334, 145,330, 154,330, 158,334, 154,341, 152,348,
+ 145,350, 149,340, 147,336, 141,339, 139,345, 136,342,
+ 136,339
+ };
+
+ init(l, 69, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly70(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {208,259, 215,259, 212,255, 220,259, 224,263, 225,274, 224,283,
+ 220,292, 208,300, 206,308, 203,304, 199,315, 197,309, 195,318,
+ 193,313, 190,322, 190,316, 185,325, 182,318, 180,325, 172,321,
+ 178,320, 176,313, 186,312, 180,307, 188,307, 184,303, 191,302,
+ 186,299, 195,294, 187,290, 197,288, 192,286, 201,283, 194,280,
+ 203,277, 198,275, 207,271, 200,269, 209,265, 204,265, 212,262
+ };
+
+ init(l, 70, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly71(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {106,126, 106,131, 109,132, 111,134, 115,132, 115,135, 119,133, 118,137,
+ 123,137, 128,137, 133,134, 136,130, 136,127, 132,124, 118,128, 112,128,
+ 106,126, 106,126, 106,126
+ };
+
+ init(l, 71, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly72(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {107,114, 101,110, 98,102, 105,97, 111,98, 119,102, 121,108, 118,112, 113,115
+ };
+
+ init(l, 72, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly73(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {148,106, 145,110, 146,116, 150,118, 152,111, 151,107
+ };
+
+ init(l, 73, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly74(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {80,55, 70,52, 75,58, 63,57, 72,61, 57,61, 67,66, 57,67, 62,69, 54,71,
+ 61,73, 54,77, 63,78, 53,85, 60,84, 56,90, 69,84, 63,82, 75,76, 70,75,
+ 77,72, 72,71, 78,69, 72,66, 81,67, 78,64, 82,63, 80,60, 86,62
+ };
+
+ init(l, 74, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly75(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {87,56, 91,52, 96,50, 102,56, 98,56, 92,60
+ };
+
+ init(l, 75, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly76(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {85,68, 89,73, 98,76, 106,74, 96,73, 91,70
+ };
+
+ init(l, 76, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly77(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {115,57, 114,64, 111,64, 115,75, 122,81, 122,74, 126,79,
+ 126,74, 131,78, 130,72, 133,77, 131,68, 126,61, 119,57
+ };
+
+ init(l, 77, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly78(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {145,48, 143,53, 147,59, 151,59, 150,55
+ };
+
+ init(l, 78, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly79(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {26,22, 34,15, 43,10, 52,10, 59,16, 47,15, 32,22
+ };
+
+ init(l, 79, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly80(struct lion *l)
+{
+ VGfloat color = 0xffe5b2;
+ static const VGfloat coords[] = {160,19, 152,26, 149,34, 154,33, 152,30, 157,30, 155,26, 158,27,
+ 157,23, 161,23
+ };
+
+ init(l, 80, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly81(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {98,117, 105,122, 109,122, 105,117, 113,120, 121,120, 130,112, 128,108,
+ 123,103, 123,99, 128,101, 132,106, 135,109, 142,105, 142,101, 145,101,
+ 145,91, 148,101, 145,105, 136,112, 135,116, 143,124, 148,120, 150,122,
+ 142,128, 133,122, 121,125, 112,126, 103,125, 100,129, 96,124
+ };
+
+ init(l, 81, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly82(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {146,118, 152,118, 152,115, 149,115
+ };
+
+ init(l, 82, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly83(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {148,112, 154,111, 154,109, 149,109
+ };
+
+ init(l, 83, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly84(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {106,112, 108,115, 114,116, 118,114
+ };
+
+ init(l, 84, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly85(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {108,108, 111,110, 116,110, 119,108
+ };
+
+ init(l, 85, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly86(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {106,104, 109,105, 117,106, 115,104
+ };
+
+ init(l, 86, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly87(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {50,25, 41,26, 34,33, 39,43, 49,58, 36,51, 47,68, 55,69, 54,59,
+ 61,57, 74,46, 60,52, 67,42, 57,48, 61,40, 54,45, 60,36, 59,29,
+ 48,38, 52,30, 47,32
+ };
+
+ init(l, 87, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly88(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {147,34, 152,41, 155,49, 161,53, 157,47, 164,47, 158,43, 168,44,
+ 159,40, 164,37, 169,37, 164,33, 169,34, 165,28, 170,30, 170,25,
+ 173,29, 175,27, 176,32, 173,36, 175,39, 172,42, 172,46, 168,49,
+ 170,55, 162,57, 158,63, 155,58, 153,50, 149,46
+ };
+
+ init(l, 88, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly89(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {155,71, 159,80, 157,93, 157,102, 155,108, 150,101, 149,93,
+ 154,101, 152,91, 151,83, 155,79
+ };
+
+ init(l, 89, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly90(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {112,78, 115,81, 114,91, 112,87, 113,82
+ };
+
+ init(l, 90, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly91(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {78,28, 64,17, 58,11, 47,9, 36,10, 28,16, 21,26, 18,41,
+ 20,51, 23,61, 33,65, 28,68, 37,74, 36,81, 43,87, 48,90,
+ 43,100, 40,98, 39,90, 31,80, 30,72, 22,71, 17,61, 14,46,
+ 16,28, 23,17, 33,9, 45,6, 54,6, 65,12
+ };
+
+ init(l, 91, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly92(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {67,18, 76,9, 87,5, 101,2, 118,3, 135,8, 149,20, 149,26,
+ 144,19, 132,12, 121,9, 105,7, 89,8, 76,14, 70,20
+ };
+
+ init(l, 92, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly93(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {56,98, 48,106, 56,103, 47,112, 56,110, 52,115, 57,113, 52,121, 62,115,
+ 58,123, 65,119, 63,125, 69,121, 68,127, 74,125, 74,129, 79,128, 83,132,
+ 94,135, 93,129, 85,127, 81,122, 76,126, 75,121, 71,124, 71,117, 66,121,
+ 66,117, 62,117, 64,112, 60,113, 60,110, 57,111, 61,105, 57,107, 60,101,
+ 55,102
+ };
+
+ init(l, 93, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly94(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {101,132, 103,138, 106,134, 106,139, 112,136, 111,142, 115,139,
+ 114,143, 119,142, 125,145, 131,142, 135,138, 140,134, 140,129,
+ 143,135, 145,149, 150,171, 149,184, 145,165, 141,150, 136,147,
+ 132,151, 131,149, 126,152, 125,150, 121,152, 117,148, 111,152,
+ 110,148, 105,149, 104,145, 98,150, 96,138, 94,132, 94,130, 98,132
+ };
+
+ init(l, 94, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly95(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {41,94, 32,110, 23,132, 12,163, 6,190, 7,217, 5,236,
+ 3,247, 9,230, 12,211, 12,185, 18,160, 26,134, 35,110,
+ 43,99
+ };
+
+ init(l, 95, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly96(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {32,246, 41,250, 50,257, 52,267, 53,295, 53,323, 59,350,
+ 54,363, 51,365, 44,366, 42,360, 40,372, 54,372, 59,366,
+ 62,353, 71,352, 75,335, 73,330, 66,318, 68,302, 64,294,
+ 67,288, 63,286, 63,279, 59,275, 58,267, 56,262, 50,247,
+ 42,235, 44,246, 32,236, 35,244
+ };
+
+ init(l, 96, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly97(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {134,324, 146,320, 159,322, 173,327, 179,337, 179,349,
+ 172,355, 158,357, 170,350, 174,343, 170,333, 163,328, 152,326,
+ 134,329
+ };
+
+ init(l, 97, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly98(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {173,339, 183,334, 184,338, 191,329, 194,332, 199,323, 202,325,
+ 206,318, 209,320, 213,309, 221,303, 228,296, 232,289, 234,279,
+ 233,269, 230,262, 225,256, 219,253, 208,252, 198,252, 210,249,
+ 223,250, 232,257, 237,265, 238,277, 238,291, 232,305, 221,323,
+ 218,335, 212,342, 200,349, 178,348
+ };
+
+ init(l, 98, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly99(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {165,296, 158,301, 156,310, 156,323, 162,324, 159,318,
+ 162,308, 162,304
+ };
+
+ init(l, 99, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly100(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {99,252, 105,244, 107,234, 115,228, 121,228, 131,235,
+ 122,233, 113,235, 109,246, 121,239, 133,243, 121,243,
+ 110,251
+ };
+
+ init(l, 100, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly101(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {117,252, 124,247, 134,249, 136,253, 126,252
+ };
+
+ init(l, 101, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly102(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {117,218, 132,224, 144,233, 140,225, 132,219, 117,218,
+ 117,218, 117,218
+ };
+
+ init(l, 102, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly103(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {122,212, 134,214, 143,221, 141,213, 132,210
+ };
+
+ init(l, 103, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly104(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {69,352, 70,363, 76,373, 86,378, 97,379, 108,379, 120,377,
+ 128,378, 132,373, 135,361, 133,358, 132,366, 127,375, 121,374,
+ 121,362, 119,367, 117,374, 110,376, 110,362, 107,357, 106,371,
+ 104,375, 97,376, 90,375, 90,368, 86,362, 83,364, 86,369, 85,373,
+ 78,370, 73,362, 71,351
+ };
+
+ init(l, 104, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly105(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {100,360, 96,363, 99,369, 102,364
+ };
+
+ init(l, 105, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly106(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {115,360, 112,363, 114,369, 117,364
+ };
+
+ init(l, 106, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly107(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {127,362, 125,364, 126,369, 128,365
+ };
+
+ init(l, 107, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly108(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {5,255, 7,276, 11,304, 15,320, 13,334, 6,348, 2,353, 0,363,
+ 5,372, 12,374, 25,372, 38,372, 44,369, 42,367, 36,368, 31,369,
+ 30,360, 27,368, 20,370, 16,361, 15,368, 10,369, 3,366, 3,359, 6,352,
+ 11,348, 17,331, 19,316, 12,291, 9,274
+ };
+
+ init(l, 108, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly109(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {10,358, 7,362, 10,366, 11,362
+ };
+
+ init(l, 109, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly110(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {25,357, 22,360, 24,366, 27,360
+ };
+
+ init(l, 110, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly111(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {37,357, 34,361, 36,365, 38,361
+ };
+
+ init(l, 111, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly112(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {49,356, 46,359, 47,364, 50,360
+ };
+
+ init(l, 112, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly113(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {130,101, 132,102, 135,101, 139,102, 143,103,
+ 142,101, 137,100, 133,100
+ };
+
+ init(l, 113, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly114(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {106,48, 105,52, 108,56, 109,52
+ };
+
+ init(l, 114, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly115(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {139,52, 139,56, 140,60, 142,58, 141,56
+ };
+
+ init(l, 115, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly116(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {25,349, 29,351, 30,355, 33,350, 37,348, 42,351, 45,347,
+ 49,345, 44,343, 36,345
+ };
+
+ init(l, 116, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly117(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {98,347, 105,351, 107,354, 109,349, 115,349, 120,353, 118,349,
+ 113,346, 104,346
+ };
+
+ init(l, 117, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly118(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {83,348, 87,352, 87,357, 89,351, 87,348
+ };
+
+ init(l, 118, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly119(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {155,107, 163,107, 170,107, 186,108, 175,109, 155,109
+ };
+
+ init(l, 119, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly120(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {153,114, 162,113, 175,112, 192,114, 173,114, 154,115
+ };
+
+ init(l, 120, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly121(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {152,118, 164,120, 180,123, 197,129, 169,123, 151,120
+ };
+
+ init(l, 121, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly122(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {68,109, 87,106, 107,106, 106,108, 88,108
+ };
+
+ init(l, 122, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly123(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {105,111, 95,112, 79,114, 71,116, 85,115, 102,113
+ };
+
+ init(l, 123, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly124(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {108,101, 98,99, 87,99, 78,99, 93,100, 105,102
+ };
+
+ init(l, 124, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly125(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {85,63, 91,63, 97,60, 104,60, 108,62, 111,69, 112,75,
+ 110,74, 108,71, 103,73, 106,69, 105,65, 103,64, 103,67,
+ 102,70, 99,70, 97,66, 94,67, 97,72, 88,67, 84,66
+ };
+
+ init(l, 125, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly126(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {140,74, 141,66, 144,61, 150,61, 156,62, 153,70, 150,73,
+ 152,65, 150,65, 151,68, 149,71, 146,71, 144,66, 143,70,
+ 143,74
+ };
+
+ init(l, 126, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly127(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {146,20, 156,11, 163,9, 172,9, 178,14, 182,18, 184,32, 182,42,
+ 182,52, 177,58, 176,67, 171,76, 165,90, 157,105, 160,92, 164,85,
+ 168,78, 167,73, 173,66, 172,62, 175,59, 174,55, 177,53, 180,46,
+ 181,29, 179,21, 173,13, 166,11, 159,13, 153,18, 148,23
+ };
+
+ init(l, 127, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly128(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {150,187, 148,211, 150,233, 153,247, 148,267, 135,283, 125,299,
+ 136,292, 131,313, 122,328, 122,345, 129,352, 133,359, 133,367,
+ 137,359, 148,356, 140,350, 131,347, 129,340, 132,332, 140,328,
+ 137,322, 140,304, 154,265, 157,244, 155,223, 161,220, 175,229,
+ 186,247, 185,260, 176,275, 178,287, 185,277, 188,261, 196,253,
+ 189,236, 174,213
+ };
+
+ init(l, 128, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly129(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {147,338, 142,341, 143,345, 141,354, 147,343
+ };
+
+ init(l, 129, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly130(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {157,342, 156,349, 150,356, 157,353, 163,346, 162,342
+ };
+
+ init(l, 130, color, coords, ELEMENTS(coords)/2);
+}
+
+static void poly131(struct lion *l)
+{
+ VGfloat color = 0x000000;
+ static const VGfloat coords[] = {99,265, 96,284, 92,299, 73,339, 73,333, 87,300
+ };
+
+ init(l, 131, color, coords, ELEMENTS(coords)/2);
+}
+
+
+struct lion * lion_create(void)
+{
+ struct lion *l = calloc(1, sizeof(struct lion));
+
+ poly0(l);
+ poly1(l);
+ poly2(l);
+ poly3(l);
+ poly4(l);
+ poly5(l);
+ poly6(l);
+ poly7(l);
+ poly8(l);
+ poly9(l);
+
+ poly10(l);
+ poly11(l);
+ poly12(l);
+ poly13(l);
+ poly14(l);
+ poly15(l);
+ poly16(l);
+ poly17(l);
+ poly18(l);
+ poly19(l);
+
+ poly20(l);
+ poly21(l);
+ poly22(l);
+ poly23(l);
+ poly24(l);
+ poly25(l);
+ poly26(l);
+ poly27(l);
+ poly28(l);
+ poly29(l);
+
+ poly30(l);
+ poly31(l);
+ poly32(l);
+ poly33(l);
+ poly34(l);
+ poly35(l);
+ poly36(l);
+ poly37(l);
+ poly38(l);
+ poly39(l);
+
+ poly40(l);
+ poly41(l);
+ poly42(l);
+ poly43(l);
+ poly44(l);
+ poly45(l);
+ poly46(l);
+ poly47(l);
+ poly48(l);
+ poly49(l);
+
+ poly50(l);
+ poly51(l);
+ poly52(l);
+ poly53(l);
+ poly54(l);
+ poly55(l);
+ poly56(l);
+ poly57(l);
+ poly58(l);
+ poly59(l);
+
+ poly60(l);
+ poly61(l);
+ poly62(l);
+ poly63(l);
+ poly64(l);
+ poly65(l);
+ poly66(l);
+ poly67(l);
+ poly68(l);
+ poly69(l);
+
+ poly70(l);
+ poly71(l);
+ poly72(l);
+ poly73(l);
+ poly74(l);
+ poly75(l);
+ poly76(l);
+ poly77(l);
+ poly78(l);
+ poly79(l);
+
+ poly80(l);
+ poly81(l);
+ poly82(l);
+ poly83(l);
+ poly84(l);
+ poly85(l);
+ poly86(l);
+ poly87(l);
+ poly88(l);
+ poly89(l);
+
+ poly90(l);
+ poly91(l);
+ poly92(l);
+ poly93(l);
+ poly94(l);
+ poly95(l);
+ poly96(l);
+ poly97(l);
+ poly98(l);
+ poly99(l);
+
+ poly100(l);
+ poly101(l);
+ poly102(l);
+ poly103(l);
+ poly104(l);
+ poly105(l);
+ poly106(l);
+ poly107(l);
+ poly108(l);
+ poly109(l);
+
+ poly110(l);
+ poly111(l);
+ poly112(l);
+ poly113(l);
+ poly114(l);
+ poly115(l);
+ poly116(l);
+ poly117(l);
+ poly118(l);
+ poly119(l);
+
+ poly120(l);
+ poly121(l);
+ poly122(l);
+ poly123(l);
+ poly124(l);
+ poly125(l);
+ poly126(l);
+ poly127(l);
+ poly128(l);
+ poly129(l);
+
+ poly130(l);
+ poly131(l);
+
+ return l;
+}
+
+void lion_render(struct lion *l)
+{
+ VGint i;
+
+ for (i = 0; i < LION_SIZE; ++i) {
+ vgSetPaint(l->fills[i], VG_FILL_PATH);
+ vgDrawPath(l->paths[i], VG_FILL_PATH);
+ }
+}
+
+void lion_destroy(struct lion *l)
+{
+ VGint i;
+ for (i = 0; i < LION_SIZE; ++i) {
+ vgDestroyPaint(l->fills[i]);
+ vgDestroyPath(l->paths[i]);
+ }
+ free(l);
+}
diff --git a/progs/openvg/demos/lion-render.h b/progs/openvg/demos/lion-render.h
new file mode 100644
index 00000000000..c4c020b7edd
--- /dev/null
+++ b/progs/openvg/demos/lion-render.h
@@ -0,0 +1,16 @@
+#ifndef LION_RENDER_H
+#define LION_RENDER_H
+
+#include <VG/openvg.h>
+
+#define LION_SIZE 132
+struct lion {
+ VGPath paths[LION_SIZE];
+ VGPaint fills[LION_SIZE];
+};
+
+struct lion *lion_create(void);
+void lion_render(struct lion *l);
+void lion_destroy(struct lion *l);
+
+#endif
diff --git a/progs/openvg/demos/lion.c b/progs/openvg/demos/lion.c
new file mode 100644
index 00000000000..7224fed399d
--- /dev/null
+++ b/progs/openvg/demos/lion.c
@@ -0,0 +1,288 @@
+#include <assert.h>
+#include <math.h>
+#include <stdlib.h>
+#include <stdio.h>
+#include <string.h>
+#include <X11/Xlib.h>
+#include <X11/Xutil.h>
+#include <X11/keysym.h>
+#include <VG/openvg.h>
+#include <GLES/egl.h>
+
+#include "lion-render.h"
+
+static VGint width, height;
+struct lion *lion = 0;
+VGfloat angle = 0;
+
+static void
+draw(void)
+{
+ vgClear(0, 0, width, height);
+
+ vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE);
+ vgLoadIdentity();
+ vgTranslate(width/2, height/2);
+ vgRotate(angle);
+ vgTranslate(-width/2, -height/2);
+
+ lion_render(lion);
+
+ ++angle;
+}
+
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ width = w;
+ height = h;
+}
+
+
+static void
+init(void)
+{
+ float clear_color[4] = {1.0, 1.0, 1.0, 1.0};
+ vgSetfv(VG_CLEAR_COLOR, 4, clear_color);
+
+ lion = lion_create();
+}
+
+
+/*
+ * Create an RGB, double-buffered X window.
+ * Return the window and context handles.
+ */
+static void
+make_x_window(Display *x_dpy, EGLDisplay egl_dpy,
+ const char *name,
+ int x, int y, int width, int height,
+ Window *winRet,
+ EGLContext *ctxRet,
+ EGLSurface *surfRet)
+{
+ static const EGLint attribs[] = {
+ EGL_RED_SIZE, 1,
+ EGL_GREEN_SIZE, 1,
+ EGL_BLUE_SIZE, 1,
+ EGL_NONE
+ };
+
+ int scrnum;
+ XSetWindowAttributes attr;
+ unsigned long mask;
+ Window root;
+ Window win;
+ XVisualInfo *visInfo, visTemplate;
+ int num_visuals;
+ EGLContext ctx;
+ EGLConfig config;
+ EGLint num_configs;
+ EGLint vid;
+
+ scrnum = DefaultScreen( x_dpy );
+ root = RootWindow( x_dpy, scrnum );
+
+ if (!eglChooseConfig( egl_dpy, attribs, &config, 1, &num_configs)) {
+ printf("Error: couldn't get an EGL visual config\n");
+ exit(1);
+ }
+
+ assert(config);
+ assert(num_configs > 0);
+
+ if (!eglGetConfigAttrib(egl_dpy, config, EGL_NATIVE_VISUAL_ID, &vid)) {
+ printf("Error: eglGetConfigAttrib() failed\n");
+ exit(1);
+ }
+
+ /* The X window visual must match the EGL config */
+ visTemplate.visualid = vid;
+ visInfo = XGetVisualInfo(x_dpy, VisualIDMask, &visTemplate, &num_visuals);
+ if (!visInfo) {
+ printf("Error: couldn't get X visual\n");
+ exit(1);
+ }
+
+ /* window attributes */
+ attr.background_pixel = 0;
+ attr.border_pixel = 0;
+ attr.colormap = XCreateColormap( x_dpy, root, visInfo->visual, AllocNone);
+ attr.event_mask = StructureNotifyMask | ExposureMask | KeyPressMask;
+ mask = CWBackPixel | CWBorderPixel | CWColormap | CWEventMask;
+
+ win = XCreateWindow( x_dpy, root, 0, 0, width, height,
+ 0, visInfo->depth, InputOutput,
+ visInfo->visual, mask, &attr );
+
+ /* set hints and properties */
+ {
+ XSizeHints sizehints;
+ sizehints.x = x;
+ sizehints.y = y;
+ sizehints.width = width;
+ sizehints.height = height;
+ sizehints.flags = USSize | USPosition;
+ XSetNormalHints(x_dpy, win, &sizehints);
+ XSetStandardProperties(x_dpy, win, name, name,
+ None, (char **)NULL, 0, &sizehints);
+ }
+
+ eglBindAPI(EGL_OPENVG_API);
+
+ ctx = eglCreateContext(egl_dpy, config, EGL_NO_CONTEXT, NULL );
+ if (!ctx) {
+ printf("Error: eglCreateContext failed\n");
+ exit(1);
+ }
+
+ *surfRet = eglCreateWindowSurface(egl_dpy, config, win, NULL);
+
+ if (!*surfRet) {
+ printf("Error: eglCreateWindowSurface failed\n");
+ exit(1);
+ }
+
+ XFree(visInfo);
+
+ *winRet = win;
+ *ctxRet = ctx;
+}
+
+
+static void
+event_loop(Display *dpy, Window win,
+ EGLDisplay egl_dpy, EGLSurface egl_surf)
+{
+ while (1) {
+ XEvent event;
+
+ while (XPending(dpy) > 0) {
+ XNextEvent(dpy, &event);
+
+ switch (event.type) {
+ case Expose:
+ break;
+ case ConfigureNotify:
+ reshape(event.xconfigure.width, event.xconfigure.height);
+ break;
+ case KeyPress:
+ {
+ char buffer[10];
+ int r, code;
+ code = XLookupKeysym(&event.xkey, 0);
+ r = XLookupString(&event.xkey, buffer, sizeof(buffer),
+ NULL, NULL);
+ if (buffer[0] == 27) {
+ /* escape */
+ return;
+ }
+ }
+ break;
+ default:
+ ; /*no-op*/
+ }
+ }
+
+ draw();
+ eglSwapBuffers(egl_dpy, egl_surf);
+ }
+}
+
+
+static void
+usage(void)
+{
+ printf("Usage:\n");
+ printf(" -display <displayname> set the display to run on\n");
+ printf(" -info display OpenGL renderer info\n");
+}
+
+int
+main(int argc, char *argv[])
+{
+ const int winWidth = 350, winHeight = 450;
+ Display *x_dpy;
+ Window win;
+ EGLSurface egl_surf;
+ EGLContext egl_ctx;
+ EGLDisplay egl_dpy;
+ char *dpyName = NULL;
+ GLboolean printInfo = GL_FALSE;
+ EGLint egl_major, egl_minor;
+ int i;
+ const char *s;
+
+ for (i = 1; i < argc; i++) {
+ if (strcmp(argv[i], "-display") == 0) {
+ dpyName = argv[i+1];
+ i++;
+ }
+ else if (strcmp(argv[i], "-info") == 0) {
+ printInfo = GL_TRUE;
+ }
+ else {
+ usage();
+ return -1;
+ }
+ }
+
+ x_dpy = XOpenDisplay(dpyName);
+ if (!x_dpy) {
+ printf("Error: couldn't open display %s\n",
+ dpyName ? dpyName : getenv("DISPLAY"));
+ return -1;
+ }
+
+ egl_dpy = eglGetDisplay(x_dpy);
+ if (!egl_dpy) {
+ printf("Error: eglGetDisplay() failed\n");
+ return -1;
+ }
+
+ if (!eglInitialize(egl_dpy, &egl_major, &egl_minor)) {
+ printf("Error: eglInitialize() failed\n");
+ return -1;
+ }
+
+ s = eglQueryString(egl_dpy, EGL_VERSION);
+ printf("EGL_VERSION = %s\n", s);
+
+ make_x_window(x_dpy, egl_dpy,
+ "Lion Example", 0, 0, winWidth, winHeight,
+ &win, &egl_ctx, &egl_surf);
+
+ XMapWindow(x_dpy, win);
+ if (!eglMakeCurrent(egl_dpy, egl_surf, egl_surf, egl_ctx)) {
+ printf("Error: eglMakeCurrent() failed\n");
+ return -1;
+ }
+
+ if (printInfo) {
+ printf("VG_RENDERER = %s\n", (char *) vgGetString(VG_RENDERER));
+ printf("VG_VERSION = %s\n", (char *) vgGetString(VG_VERSION));
+ printf("VG_VENDOR = %s\n", (char *) vgGetString(VG_VENDOR));
+ }
+
+ init();
+
+ /* Set initial projection/viewing transformation.
+ * We can't be sure we'll get a ConfigureNotify event when the window
+ * first appears.
+ */
+ reshape(winWidth, winHeight);
+
+ event_loop(x_dpy, win, egl_dpy, egl_surf);
+
+ eglDestroyContext(egl_dpy, egl_ctx);
+ eglDestroySurface(egl_dpy, egl_surf);
+ eglTerminate(egl_dpy);
+
+
+ XDestroyWindow(x_dpy, win);
+ XCloseDisplay(x_dpy);
+
+ return 0;
+}
diff --git a/progs/openvg/demos/sp.c b/progs/openvg/demos/sp.c
new file mode 100644
index 00000000000..d04f252e2ec
--- /dev/null
+++ b/progs/openvg/demos/sp.c
@@ -0,0 +1,103 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+#include <VG/vgu.h>
+#include <stdio.h>
+#include <math.h>
+#include <stdlib.h>
+
+#include <X11/keysym.h>
+
+struct object {
+ VGPath path;
+ VGPaint fill;
+ VGPaint stroke;
+ VGint draw_mode;
+};
+
+struct character {
+ struct object objects[32];
+ VGint num_objects;
+};
+
+struct character cartman;
+
+static void init_character()
+{
+ struct object object;
+ VGint num_objects = 0;
+
+ {
+ const VGint num_segments = 6;
+ const VGubyte segments[] = {VG_MOVE_TO_ABS,
+ VG_CUBIC_TO_ABS,
+ VG_CUBIC_TO_ABS,
+ VG_CUBIC_TO_ABS,
+ VG_CUBIC_TO_ABS,
+ VG_CLOSE_PATH};
+ const VGfloat coords[] = {181.83267, 102.60408,
+ 181.83267,102.60408 185.53793,114.5749 186.5355,115.00243,
+ 187.53306,115.42996 286.0073,115.00243 286.0073,115.00243,
+ 286.0073,115.00243 292.70526,103.45914 290.85263,101.03648,
+ 289.00001,98.61381 181.54765,102.31906 181.83267,102.60408
+ };
+ VGuint color = 0x7c4e32ff;
+ object.path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F,
+ 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL);
+ vgAppendPathData(object.path, num_segments, segments, coords);
+
+ object.fill = vgCreatePaint();
+ vgSetColor(object.fill, color);
+ character.objects[objects.num_objects] = object;
+ ++objects.num_objects;
+ }
+ {
+
+ }
+}
+
+
+static void
+init(void)
+{
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+}
+
+int key_press(unsigned key)
+{
+ switch(key) {
+ case XK_Right:
+
+ break;
+ case XK_Left:
+ break;
+ case XK_Up:
+ break;
+ case XK_Down:
+ break;
+ case 'a':
+ break;
+ case 's':
+ break;
+ default:
+ break;
+ }
+ return VG_FALSE;
+}
+
+static void
+draw(void)
+{
+}
+
+
+int main(int argc, char **argv)
+{
+ set_window_size(400, 400);
+ return run(argc, argv, init, reshape, draw, key_press);
+}
diff --git a/progs/openvg/trivial/Makefile b/progs/openvg/trivial/Makefile
new file mode 100644
index 00000000000..362360e5963
--- /dev/null
+++ b/progs/openvg/trivial/Makefile
@@ -0,0 +1,127 @@
+# These programs aren't intended to be included with the normal distro.
+# They're not too interesting but they're good for testing.
+
+TOP = ../../../
+include $(TOP)/configs/current
+
+INCLUDES = -I. -I$(TOP)/include
+LIBS=-L$(TOP)/$(LIB_DIR) -lm -lEGL -lOpenVG -lpthread
+CFLAGS += $(INCLUDES)
+
+HEADERS=eglcommon.h
+
+PROGRAMS = \
+ arc \
+ cap \
+ clear \
+ coord \
+ dash \
+ ellipse \
+ filter \
+ gradorigin \
+ lineto \
+ lingrad \
+ lookup \
+ mask4 \
+ mask \
+ path3 \
+ radialgrad \
+ readpixels \
+ roundedrect \
+ star-nonzero \
+ star-oddeven \
+ stroke2 \
+ stroke \
+ vguarc
+
+
+.c.o:
+ $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@
+
+
+
+default: $(PROGRAMS)
+
+
+arc: arc.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+cap: cap.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+clear: clear.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+coord: coord.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+dash: dash.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+ellipse: ellipse.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+filter: filter.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+gradorigin: gradorigin.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+image: image.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+lineto: lineto.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+lingrad: lingrad.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+lookup: lookup.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+mask: mask.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+mask4: mask4.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+path3: path3.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+pattern: pattern.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+radialgrad: radialgrad.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+readpixels: readpixels.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+roundedrect: roundedrect.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+star-nonzero: star-nonzero.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+star-oddeven: star-oddeven.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+stroke: stroke.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+stroke2: stroke2.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+vguarc: vguarc.c eglcommon.o
+ $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@
+
+
+
+eglcommon.o: eglcommon.c $(HEADERS)
+ $(CC) -c $(CFLAGS) eglcommon.c
+
+
+clean:
+ rm -f *.o *~
+ rm -f *.so
+ rm -f $(PROGRAMS)
diff --git a/progs/openvg/trivial/arc.c b/progs/openvg/trivial/arc.c
new file mode 100644
index 00000000000..db686bea6b0
--- /dev/null
+++ b/progs/openvg/trivial/arc.c
@@ -0,0 +1,139 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+#include <math.h>
+
+const VGfloat clear_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {1.0, 1.0, 1.0, 0.5};
+
+VGPath vgPath;
+
+static void ellipse(VGPath vgPath, VGfloat rx, VGfloat ry, VGfloat angle)
+{
+ static const VGubyte cmd[] =
+ { VG_MOVE_TO_ABS, VG_SCCWARC_TO_REL, VG_SCCWARC_TO_REL, VG_CLOSE_PATH };
+
+ VGfloat val[12];
+ VGfloat c = cos(angle) * rx;
+ VGfloat s = sin(angle) * rx;
+
+ val[0] = c;
+ val[1] = s;
+ val[2] = rx;
+ val[3] = ry;
+ val[4] = angle;
+ val[5] = -2.0f * c;
+ val[6] = -2.0f * s;
+ val[7] = rx;
+ val[8] = ry;
+ val[9] = angle;
+ val[10] = 2.0f * c;
+ val[11] = 2.0f * s;
+
+ vgClearPath(vgPath, VG_PATH_CAPABILITY_ALL);
+ vgAppendPathData(vgPath, sizeof(cmd), cmd, val);
+ vgDrawPath(vgPath, VG_FILL_PATH | VG_STROKE_PATH);
+}
+
+static void
+init(void)
+{
+ VGPaint vgPaint;
+
+ vgSetfv(VG_CLEAR_COLOR, 4, clear_color);
+ vgPath = vgCreatePath(VG_PATH_FORMAT_STANDARD,
+ VG_PATH_DATATYPE_F, 1.0f, 0.0f, 0, 0,
+ VG_PATH_CAPABILITY_ALL);
+
+ vgPaint = vgCreatePaint();
+ vgSetParameteri(vgPaint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR);
+ vgSetColor(vgPaint, 0x00ff00ff);
+ vgSetPaint(vgPaint, VG_FILL_PATH);
+
+ vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED);
+ vgSeti(VG_BLEND_MODE, VG_BLEND_SRC_OVER);
+ vgSetf(VG_STROKE_LINE_WIDTH, 2.0f);
+ vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_SQUARE);
+ vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_MITER);
+ vgSetf(VG_STROKE_MITER_LIMIT, 4.0f);
+ vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+
+#if 0
+ vgLoadIdentity();
+ vgTranslate(40.0f, 24.0f);
+ vgScale(0.61804f, 0.61804f);
+ vgShear(-1.0f, 0.0f);
+ vgDrawPath(vgPath, VG_FILL_PATH | VG_STROKE_PATH);
+#else
+
+ /* row 1, col 1: Identity transform. */
+
+ vgLoadIdentity();
+ vgTranslate(8.0f, 8.0f);
+ ellipse(vgPath, 4.0f, 4.0f, 0.0f);
+
+ /* row 1, col 2: 10^3 horizontal squeeze. */
+
+ vgLoadIdentity();
+ vgTranslate(24.0f, 8.0f);
+ vgScale(1.0e-3f, 1.0f);
+ ellipse(vgPath, 4.0e3f, 4.0f, 0.0f);
+
+ /* row 1, col 3: 10^6 horizontal squeeze. */
+
+ vgLoadIdentity();
+ vgTranslate(40.0f, 8.0f);
+ vgScale(1.0e-6f, 1.0f);
+ ellipse(vgPath, 4.0e6f, 4.0f, 0.0f);
+
+ /* row 1, col 4: 10^9 horizontal squeeze. */
+
+ vgLoadIdentity();
+ vgTranslate(56.0f, 8.0f);
+ vgScale(1.0e-9f, 1.0f);
+ ellipse(vgPath, 4.0e9f, 4.0f, 0.0f);
+
+ /* row 2, col 1: 10^3 vertical squeeze. */
+
+ vgLoadIdentity();
+ vgTranslate(8.0f, 24.0f);
+ vgScale(1.0f, 1.0e-3f);
+ ellipse(vgPath, 4.0f, 4.0e3f, 0.0f);
+
+ /* row 2, col 2: Shear 0. */
+
+ vgLoadIdentity();
+ vgTranslate(24.0f, 24.0f);
+ vgShear(0.0f, 0.0f);
+ ellipse(vgPath, 4.0f, 4.0f, 0.0f);
+
+ /* row 2, col 3: Horizontal shear -1. */
+
+ vgLoadIdentity();
+ vgTranslate(40.0f, 24.0f);
+ vgScale(0.61804f, 0.61804f);
+ vgShear(-1.0f, 0.0f);
+ ellipse(vgPath, 10.47213f, 4.0f, 31.717f);
+#endif
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ set_window_size(64, 64);
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/cap.c b/progs/openvg/trivial/cap.c
new file mode 100644
index 00000000000..cd84fe3ac00
--- /dev/null
+++ b/progs/openvg/trivial/cap.c
@@ -0,0 +1,75 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+#include <math.h>
+#include <stdlib.h>
+#include <stdio.h>
+
+static void
+init(void)
+{
+
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+}
+
+const int subtest = 0;
+static void
+draw(void)
+{
+ VGPath line;
+ VGPaint fillPaint;
+ VGubyte lineCommands[3] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS};
+ VGfloat lineCoords[] = {-2.0f,-1.0f, 0.0f,0.0f, -1.0f, -2.0f};
+ VGfloat clearColor[] = {0.0f, 0.0f, 0.0f, 1.0f};/* black color */
+ VGfloat fillColor[] = {1.0f, 1.0f, 1.0f, 1.0f};/* white color */
+ //VGfloat testRadius = 60.0f;
+ VGfloat testRadius = 10.0f;
+ int WINDSIZEX = window_width();
+ int WINDSIZEY = window_height();
+
+ line = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F,
+ 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL);
+ fillPaint = vgCreatePaint();
+
+ vgSetf(VG_STROKE_LINE_WIDTH, 1.0f);
+ //vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_ROUND);
+ vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT);
+ vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND);
+ //vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_BEVEL);
+
+ vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_BETTER);
+
+ vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE);
+ vgLoadIdentity();
+ vgTranslate(60, 60);
+ vgScale(testRadius * 2, testRadius * 2);
+
+ vgAppendPathData(line, 3, lineCommands, lineCoords);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, clearColor);
+
+ vgSetPaint(fillPaint, VG_STROKE_PATH);
+
+ vgSetParameterfv(fillPaint, VG_PAINT_COLOR, 4, fillColor);
+ vgSetParameteri( fillPaint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR);
+
+ vgClear(0, 0, WINDSIZEX, WINDSIZEY);
+ vgDrawPath(line, VG_STROKE_PATH);
+
+ vgDestroyPath(line);
+ vgDestroyPaint(fillPaint);
+}
+
+
+int main(int argc, char **argv)
+{
+ set_window_size(100, 100);
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/clear.c b/progs/openvg/trivial/clear.c
new file mode 100644
index 00000000000..efb6bf41820
--- /dev/null
+++ b/progs/openvg/trivial/clear.c
@@ -0,0 +1,42 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+#include <stdio.h>
+
+float red_color[4] = {1.0, 0.0, 0.0, 1.0};
+float blue_color[4] = {0.0, 0.0, 1.0, 1.0};
+
+static void
+init(void)
+{
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ VGint scissor[4] = {100, 100, 25, 25};
+ vgSetfv(VG_CLEAR_COLOR, 4, red_color);
+ vgClear(0, 0, window_width(), window_height());
+
+ vgSetfv(VG_CLEAR_COLOR, 4, blue_color);
+ vgClear(50, 50, 50, 50);
+
+ //vgSetiv(VG_SCISSOR_RECTS, 4, scissor);
+ //vgSeti(VG_SCISSORING, VG_TRUE);
+ vgCopyPixels(100, 100, 50, 50, 50, 50);
+ vgClear(150, 150, 50, 50);
+}
+
+
+int main(int argc, char **argv)
+{
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/coord.c b/progs/openvg/trivial/coord.c
new file mode 100644
index 00000000000..81f7cb6fc9e
--- /dev/null
+++ b/progs/openvg/trivial/coord.c
@@ -0,0 +1,66 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0};
+
+VGPath path;
+VGPaint fill;
+
+
+static void
+init(void)
+{
+ /* Absent VG_CLOSE_PATH */
+ VGubyte commands[] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS,
+ VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS};
+ VGfloat clearColor[] = {1.0f, 1.0f, 1.0f, 1.0f};/* white color */
+ VGfloat fillColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */
+ VGfloat coords[] = {-16.0f, -16.0f, 0.0f, -16.0f, 0.0f, 0.0f, -16.0f, 0.0f,
+ 0.0f, 0.0f, 16.0f, 0.0f, 16.0f, 16.0f, 0.0f, 16.0f};
+
+ vgSetfv(VG_CLEAR_COLOR, 4, clearColor);
+ vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED);
+
+ vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE);
+ vgLoadIdentity();
+ vgTranslate(32.0f, 32.0f);
+
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1.0f, 0.0f, 0, 0,
+ VG_PATH_CAPABILITY_ALL);
+ if (path == VG_INVALID_HANDLE)
+ return;
+ fill = vgCreatePaint();
+ if (fill == VG_INVALID_HANDLE) {
+ vgDestroyPath(path);
+ return;
+ }
+ vgAppendPathData(path, 8, commands, coords);
+ vgSetPaint(fill, VG_FILL_PATH);
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, fillColor);
+ vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+ vgDrawPath(path, VG_FILL_PATH);
+
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ set_window_size(64, 64);
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/dash.c b/progs/openvg/trivial/dash.c
new file mode 100644
index 00000000000..2e84ddbd4ea
--- /dev/null
+++ b/progs/openvg/trivial/dash.c
@@ -0,0 +1,95 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+#include <X11/keysym.h>
+#include <stdio.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0};
+
+VGPath path;
+VGPaint fill;
+
+VGint cap_style = VG_CAP_BUTT;
+
+static void
+init(void)
+{
+ static const VGubyte cmds[] = {VG_MOVE_TO_ABS,
+ VG_LINE_TO_ABS,
+ VG_LINE_TO_ABS
+ };
+#if 1
+ static const VGfloat coords[] = {100, 100, 150, 100,
+ 150, 200
+ };
+#else
+ static const VGfloat coords[] = {100, 20, 100, 220,
+ };
+#endif
+ VGfloat dash_pattern[2] = { 20.f, 20.f };
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0,
+ VG_PATH_CAPABILITY_APPEND_TO);
+ vgAppendPathData(path, 3, cmds, coords);
+
+ fill = vgCreatePaint();
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color);
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, white_color);
+ vgSetf(VG_STROKE_LINE_WIDTH, 20);
+ vgSeti(VG_STROKE_CAP_STYLE, cap_style);
+ vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND);
+ vgSetfv(VG_STROKE_DASH_PATTERN, 2, dash_pattern);
+ vgSetf(VG_STROKE_DASH_PHASE, 0.0f);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+ vgDrawPath(path, VG_STROKE_PATH);
+
+ vgFlush();
+}
+
+static int key_press(unsigned key)
+{
+ switch(key) {
+ case XK_c:
+ case XK_C:
+ ++cap_style;
+ if (cap_style > VG_CAP_SQUARE)
+ cap_style = VG_CAP_BUTT;
+ switch(cap_style) {
+ case VG_CAP_BUTT:
+ fprintf(stderr, "Cap style 'butt'\n");
+ break;
+ case VG_CAP_ROUND:
+ fprintf(stderr, "Cap style 'round'\n");
+ break;
+ case VG_CAP_SQUARE:
+ fprintf(stderr, "Cap style 'square'\n");
+ break;
+ }
+ vgSeti(VG_STROKE_CAP_STYLE, cap_style);
+ break;
+ default:
+ break;
+ }
+
+ return VG_TRUE;
+}
+
+int main(int argc, char **argv)
+{
+ return run(argc, argv, init, reshape,
+ draw, key_press);
+}
diff --git a/progs/openvg/trivial/eglcommon.c b/progs/openvg/trivial/eglcommon.c
new file mode 100644
index 00000000000..bacd5685d75
--- /dev/null
+++ b/progs/openvg/trivial/eglcommon.c
@@ -0,0 +1,288 @@
+#include "eglcommon.h"
+
+
+#include <assert.h>
+#include <math.h>
+#include <stdlib.h>
+#include <stdio.h>
+#include <string.h>
+#include <X11/Xlib.h>
+#include <X11/Xutil.h>
+#include <X11/keysym.h>
+#include <VG/openvg.h> /* using full OpenGL for now */
+#include <GLES/egl.h>
+
+
+static init_func init = 0;
+static draw_func draw = 0;
+static reshape_func reshape = 0;
+static key_func keyPress = 0;
+static VGint width = 300, height = 300;
+
+
+void set_window_size(int w, int h)
+{
+ width = w;
+ height = h;
+}
+
+/*
+ * Create an RGB, double-buffered X window.
+ * Return the window and context handles.
+ */
+static void
+make_x_window(Display *x_dpy, EGLDisplay egl_dpy,
+ const char *name,
+ int x, int y, int width, int height,
+ Window *winRet,
+ EGLContext *ctxRet,
+ EGLSurface *surfRet)
+{
+ static const EGLint attribs[] = {
+ EGL_RED_SIZE, 1,
+ EGL_GREEN_SIZE, 1,
+ EGL_BLUE_SIZE, 1,
+ EGL_NONE
+ };
+
+ int scrnum;
+ XSetWindowAttributes attr;
+ unsigned long mask;
+ Window root;
+ Window win;
+ XVisualInfo *visInfo, visTemplate;
+ int num_visuals;
+ EGLContext ctx;
+ EGLConfig config;
+ EGLint num_configs;
+ EGLint vid;
+
+ scrnum = DefaultScreen( x_dpy );
+ root = RootWindow( x_dpy, scrnum );
+
+ if (!eglChooseConfig( egl_dpy, attribs, &config, 1, &num_configs)) {
+ printf("Error: couldn't get an EGL visual config\n");
+ exit(1);
+ }
+
+ assert(config);
+ assert(num_configs > 0);
+
+ if (!eglGetConfigAttrib(egl_dpy, config, EGL_NATIVE_VISUAL_ID, &vid)) {
+ printf("Error: eglGetConfigAttrib() failed\n");
+ exit(1);
+ }
+
+ /* The X window visual must match the EGL config */
+ visTemplate.visualid = vid;
+ visInfo = XGetVisualInfo(x_dpy, VisualIDMask, &visTemplate, &num_visuals);
+ if (!visInfo) {
+ printf("Error: couldn't get X visual\n");
+ exit(1);
+ }
+
+ /* window attributes */
+ attr.background_pixel = 0;
+ attr.border_pixel = 0;
+ attr.colormap = XCreateColormap( x_dpy, root, visInfo->visual, AllocNone);
+ attr.event_mask = StructureNotifyMask | ExposureMask | KeyPressMask;
+ mask = CWBackPixel | CWBorderPixel | CWColormap | CWEventMask;
+
+ win = XCreateWindow( x_dpy, root, 0, 0, width, height,
+ 0, visInfo->depth, InputOutput,
+ visInfo->visual, mask, &attr );
+
+ /* set hints and properties */
+ {
+ XSizeHints sizehints;
+ sizehints.x = x;
+ sizehints.y = y;
+ sizehints.width = width;
+ sizehints.height = height;
+ sizehints.flags = USSize | USPosition;
+ XSetNormalHints(x_dpy, win, &sizehints);
+ XSetStandardProperties(x_dpy, win, name, name,
+ None, (char **)NULL, 0, &sizehints);
+ }
+
+ eglBindAPI(EGL_OPENVG_API);
+
+ ctx = eglCreateContext(egl_dpy, config, EGL_NO_CONTEXT, NULL );
+ if (!ctx) {
+ printf("Error: eglCreateContext failed\n");
+ exit(1);
+ }
+
+ *surfRet = eglCreateWindowSurface(egl_dpy, config, win, NULL);
+
+ if (!*surfRet) {
+ printf("Error: eglCreateWindowSurface failed\n");
+ exit(1);
+ }
+
+ XFree(visInfo);
+
+ *winRet = win;
+ *ctxRet = ctx;
+}
+
+static void
+event_loop(Display *dpy, Window win,
+ EGLDisplay egl_dpy, EGLSurface egl_surf)
+{
+ while (1) {
+ int redraw = 0;
+ XEvent event;
+
+ XNextEvent(dpy, &event);
+
+ switch (event.type) {
+ case Expose:
+ redraw = 1;
+ break;
+ case ConfigureNotify:
+ if (reshape) {
+ width = event.xconfigure.width;
+ height = event.xconfigure.height;
+ reshape(event.xconfigure.width, event.xconfigure.height);
+ }
+ break;
+ case KeyPress:
+ {
+ char buffer[10];
+ int r, code;
+ code = XLookupKeysym(&event.xkey, 0);
+ if (!keyPress || !keyPress(code)) {
+ r = XLookupString(&event.xkey, buffer, sizeof(buffer),
+ NULL, NULL);
+ if (buffer[0] == 27) {
+ /* escape */
+ return;
+ }
+ }
+ }
+ redraw = 1;
+ break;
+ default:
+ ; /*no-op*/
+ }
+
+ if (redraw) {
+ draw();
+ eglSwapBuffers(egl_dpy, egl_surf);
+ }
+ }
+}
+
+int window_width(void)
+{
+ return width;
+}
+
+int window_height(void)
+{
+ return height;
+}
+
+static void
+usage(void)
+{
+ printf("Usage:\n");
+ printf(" -display <displayname> set the display to run on\n");
+ printf(" -info display OpenGL renderer info\n");
+}
+
+int run(int argc, char **argv,
+ init_func init_f,
+ reshape_func resh_f,
+ draw_func draw_f,
+ key_func key_f)
+{
+ const int winWidth = width, winHeight = height;
+ Display *x_dpy;
+ Window win;
+ EGLSurface egl_surf;
+ EGLContext egl_ctx;
+ EGLDisplay egl_dpy;
+ char *dpyName = NULL;
+ GLboolean printInfo = GL_FALSE;
+ EGLint egl_major, egl_minor;
+ int i;
+ const char *s;
+
+ init = init_f;
+ draw = draw_f;
+ reshape = resh_f;
+ keyPress = key_f;
+
+ for (i = 1; i < argc; i++) {
+ if (strcmp(argv[i], "-display") == 0) {
+ dpyName = argv[i+1];
+ i++;
+ }
+ else if (strcmp(argv[i], "-info") == 0) {
+ printInfo = GL_TRUE;
+ }
+ }
+
+ x_dpy = XOpenDisplay(dpyName);
+ if (!x_dpy) {
+ printf("Error: couldn't open display %s\n",
+ dpyName ? dpyName : getenv("DISPLAY"));
+ return -1;
+ }
+
+ egl_dpy = eglGetDisplay(x_dpy);
+ if (!egl_dpy) {
+ printf("Error: eglGetDisplay() failed\n");
+ return -1;
+ }
+
+ if (!eglInitialize(egl_dpy, &egl_major, &egl_minor)) {
+ printf("Error: eglInitialize() failed\n");
+ return -1;
+ }
+
+ s = eglQueryString(egl_dpy, EGL_VERSION);
+ printf("EGL_VERSION = %s\n", s);
+
+ make_x_window(x_dpy, egl_dpy,
+ "OpenVG Example", 0, 0, winWidth, winHeight,
+ &win, &egl_ctx, &egl_surf);
+
+ XMapWindow(x_dpy, win);
+ if (!eglMakeCurrent(egl_dpy, egl_surf, egl_surf, egl_ctx)) {
+ printf("Error: eglMakeCurrent() failed\n");
+ return -1;
+ }
+
+ if (printInfo) {
+ printf("VG_RENDERER = %s\n", (char *) vgGetString(VG_RENDERER));
+ printf("VG_VERSION = %s\n", (char *) vgGetString(VG_VERSION));
+ printf("VG_VENDOR = %s\n", (char *) vgGetString(VG_VENDOR));
+ }
+
+ if (init)
+ init();
+
+ /* Set initial projection/viewing transformation.
+ * We can't be sure we'll get a ConfigureNotify event when the window
+ * first appears.
+ */
+ if (reshape)
+ reshape(winWidth, winHeight);
+
+ event_loop(x_dpy, win, egl_dpy, egl_surf);
+
+ eglMakeCurrent(egl_dpy, 0, 0, 0);
+ eglDestroyContext(egl_dpy, egl_ctx);
+ eglDestroySurface(egl_dpy, egl_surf);
+ eglTerminate(egl_dpy);
+
+
+ XDestroyWindow(x_dpy, win);
+ XCloseDisplay(x_dpy);
+
+ return 0;
+}
+
diff --git a/progs/openvg/trivial/eglcommon.h b/progs/openvg/trivial/eglcommon.h
new file mode 100644
index 00000000000..958dae9f98d
--- /dev/null
+++ b/progs/openvg/trivial/eglcommon.h
@@ -0,0 +1,20 @@
+#ifndef EGLCOMMON_H
+#define EGLCOMMON_H
+
+typedef void (*init_func)();
+typedef void (*reshape_func)(int, int);
+typedef void (*draw_func)();
+typedef int (*key_func)(unsigned key);
+
+
+void set_window_size(int width, int height);
+int window_width(void);
+int window_height(void);
+
+int run(int argc, char **argv,
+ init_func init,
+ reshape_func resh,
+ draw_func draw,
+ key_func key);
+
+#endif
diff --git a/progs/openvg/trivial/ellipse.c b/progs/openvg/trivial/ellipse.c
new file mode 100644
index 00000000000..4c7d4904f81
--- /dev/null
+++ b/progs/openvg/trivial/ellipse.c
@@ -0,0 +1,84 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+#include <math.h>
+#include <stdlib.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {0.0, 0.0, 0.0, 1.0};
+
+VGPath path;
+VGPaint paint;
+
+static void
+init(void)
+{
+ VGfloat clearColor[] = {1.0f, 1.0f, 1.0f, 1.0f};/* white color */
+ VGfloat fillColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */
+ static const VGubyte segments[4] = {VG_MOVE_TO_ABS,
+ VG_SCCWARC_TO_ABS,
+ VG_SCCWARC_TO_ABS,
+ VG_CLOSE_PATH};
+ VGfloat data[12];
+ const VGfloat cx = 0, cy=29, width=80, height=40;
+ const VGfloat hw = width * 0.5f;
+ const VGfloat hh = height * 0.5f;
+
+ data[0] = cx + hw;
+ data[1] = cy;
+ data[2] = hw;
+ data[3] = hh;
+ data[4] = 0;
+ data[5] = cx - hw;
+ data[6] = cy;
+ data[7] = hw;
+ data[8] = hh;
+ data[9] = 0;
+ data[10] = data[0];
+ data[11] = cy;
+
+ vgSetfv(VG_CLEAR_COLOR, 4, clearColor);
+ vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED);
+
+
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F,
+ 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL);
+ if (path == VG_INVALID_HANDLE) {
+ return;
+ }
+ paint = vgCreatePaint();
+ if (paint == VG_INVALID_HANDLE) {
+ vgDestroyPath(path);
+ return;
+ }
+
+ vgAppendPathData(path, 4, segments, data);
+ vgSetParameterfv(paint, VG_PAINT_COLOR, 4, fillColor);
+ vgSetParameteri( paint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR);
+ vgSetPaint(paint, VG_FILL_PATH);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+ vgLoadIdentity();
+ vgTranslate(50, 21);
+ vgDrawPath(path, VG_FILL_PATH);
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ set_window_size(100, 100);
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/filter.c b/progs/openvg/trivial/filter.c
new file mode 100644
index 00000000000..d96257a9335
--- /dev/null
+++ b/progs/openvg/trivial/filter.c
@@ -0,0 +1,107 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+#include <math.h>
+#include <stdlib.h>
+#include <stdio.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {1.0, 1.0, 1.0, 0.5};
+
+VGImage srcImg;
+VGImage dstImg;
+
+VGPaint fill;
+
+VGfloat bgCol[4] = {0.906f, 0.914f, 0.761f, 1.0f};
+
+static void
+init(void)
+{
+ VGfloat red[4];
+ VGfloat grey[4];
+ VGfloat orange[4];
+ VGfloat blue[4];
+ VGfloat black[4];
+ VGfloat white[4];
+ VGshort transKernel[49] = {0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0};
+
+ red[0] = 0.6710f;
+ red[1] = 0.1060f;
+ red[2] = 0.1330f;
+ red[3] = 1.0f;
+
+ grey[0] = 0.6347f;
+ grey[1] = 0.6561f;
+ grey[2] = 0.6057f;
+ grey[3] = 1.0f;
+
+ orange[0] = 1.0000f;
+ orange[1] = 0.8227f;
+ orange[2] = 0.5057f;
+ orange[3] = 1.0f;
+
+ blue[0] = 0.0000f;
+ blue[1] = 0.6908f;
+ blue[2] = 0.8595f;
+ blue[3] = 1.0f;
+
+ black[0] = 0;
+ black[1] = 0;
+ black[2] = 0;
+ black[3] = 1.0f;
+
+ white[0] = 1;
+ white[1] = 1;
+ white[2] = 1;
+ white[3] = 1.0f;
+
+ vgSetfv(VG_TILE_FILL_COLOR, 4, blue);
+
+ vgSeti(VG_FILTER_CHANNEL_MASK, 14);
+
+ /* Setup images */
+ srcImg = vgCreateImage(VG_sRGBA_8888, 32, 32,
+ VG_IMAGE_QUALITY_NONANTIALIASED);
+ dstImg = vgCreateImage(VG_sRGBA_8888, 32, 32,
+ VG_IMAGE_QUALITY_NONANTIALIASED);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, black);
+ vgClearImage(srcImg, 0, 0, 32, 32);
+ vgSetfv(VG_CLEAR_COLOR, 4, red);
+ vgClearImage(srcImg, 3, 3, 27, 27);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, orange);
+ vgClearImage(dstImg, 0, 0, 32, 32);
+
+ transKernel[8] = 1;
+ vgConvolve(dstImg, srcImg, 3, 3, 3, 0, transKernel,
+ 1, 0, VG_TILE_FILL);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+}
+
+static void
+draw(void)
+{
+ vgSetfv(VG_CLEAR_COLOR, 4, bgCol);
+ vgClear(0, 0, window_width(), window_height());
+ vgSeti(VG_MATRIX_MODE, VG_MATRIX_IMAGE_USER_TO_SURFACE);
+ vgLoadIdentity();
+ vgTranslate(10, 10);
+ vgDrawImage(dstImg);
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ set_window_size(64, 64);
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/gradorigin.c b/progs/openvg/trivial/gradorigin.c
new file mode 100644
index 00000000000..b376263fe5c
--- /dev/null
+++ b/progs/openvg/trivial/gradorigin.c
@@ -0,0 +1,98 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+#include <stdio.h>
+#include <string.h>
+
+static const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+
+static VGPath path;
+static VGPaint fill;
+
+VGColorRampSpreadMode spread = VG_COLOR_RAMP_SPREAD_PAD;
+
+static void
+init(void)
+{
+ VGubyte commands[5] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_CLOSE_PATH};
+ VGfloat coords[8] = {0.0f,0.0f, 32.0f,0.0f, 32.0f,32.0f, 0.0f,32.0f };
+
+ VGfloat rampStop[20] = {-0.5f, 1.0f, 1.0f, 1.0f, 1.0f,
+ 0.25f, 1.0f, 0.0f, 0.0f, 1.0f,
+ 0.75f, 0.0f, 0.0f, 1.0f, 1.0f,
+ 1.5f, 0.0f, 0.0f, 0.0f, 0.0f};
+
+ VGfloat defaultColor[] = {1.0f, 1.0f, 1.0f, 1.0f};
+ VGfloat linearGradient[4] = {0.0f, 0.0f, 0.0f, 32.0f};
+
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F,
+ 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL);
+ if (path == VG_INVALID_HANDLE)
+ return;
+
+ fill = vgCreatePaint();
+ if (fill == VG_INVALID_HANDLE) {
+ vgDestroyPath(path);
+ return;
+ }
+
+ vgSetfv(VG_CLEAR_COLOR, 4, defaultColor);
+ vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED);
+
+ vgAppendPathData(path, 5, commands, coords);
+
+ vgSetPaint(fill, VG_FILL_PATH);
+ vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_LINEAR_GRADIENT);
+ vgSetParameteri(fill, VG_PAINT_COLOR_RAMP_SPREAD_MODE,
+ VG_COLOR_RAMP_SPREAD_REPEAT);
+ vgSetParameterfv(fill, VG_PAINT_LINEAR_GRADIENT, 4, linearGradient);
+ vgSetParameterfv(fill, VG_PAINT_COLOR_RAMP_STOPS, 20, rampStop);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+
+ vgDrawPath(path, VG_FILL_PATH);
+
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ if (argc > 1) {
+ const char *arg = argv[1];
+ if (!strcmp("-pad", arg))
+ spread = VG_COLOR_RAMP_SPREAD_PAD;
+ else if (!strcmp("-repeat", arg))
+ spread = VG_COLOR_RAMP_SPREAD_REPEAT;
+ else if (!strcmp("-reflect", arg))
+ spread = VG_COLOR_RAMP_SPREAD_REFLECT;
+ }
+
+ switch(spread) {
+ case VG_COLOR_RAMP_SPREAD_PAD:
+ printf("Using spread mode: pad\n");
+ break;
+ case VG_COLOR_RAMP_SPREAD_REPEAT:
+ printf("Using spread mode: repeat\n");
+ break;
+ case VG_COLOR_RAMP_SPREAD_REFLECT:
+ printf("Using spread mode: reflect\n");
+ }
+
+ set_window_size(200, 200);
+
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/lineto.c b/progs/openvg/trivial/lineto.c
new file mode 100644
index 00000000000..94e29818116
--- /dev/null
+++ b/progs/openvg/trivial/lineto.c
@@ -0,0 +1,56 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0};
+
+VGPath path;
+VGPaint fill;
+
+
+static void
+init(void)
+{
+ static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH};
+ static const VGfloat sqrCoords[5] = {50.0f, 50.0f, 250.0f, 250.0f, 50.0f};
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0,
+ VG_PATH_CAPABILITY_APPEND_TO);
+ vgAppendPathData(path, 5, sqrCmds, sqrCoords);
+
+ fill = vgCreatePaint();
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color);
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, white_color);
+ vgSetf(VG_STROKE_LINE_WIDTH, 10);
+ vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT);
+ vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND);
+ vgSetf(VG_STROKE_MITER_LIMIT, 4.0f);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+ vgSeti(VG_MATRIX_MODE, VG_MATRIX_STROKE_PAINT_TO_USER);
+ vgLoadIdentity();
+ vgScale(2.25, 2.25);
+ vgDrawPath(path, VG_STROKE_PATH);
+
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/lingrad.c b/progs/openvg/trivial/lingrad.c
new file mode 100644
index 00000000000..bcaad1f1015
--- /dev/null
+++ b/progs/openvg/trivial/lingrad.c
@@ -0,0 +1,87 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+#include <stdio.h>
+#include <string.h>
+
+static const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+
+static VGPath path;
+static VGPaint fill;
+
+VGColorRampSpreadMode spread = VG_COLOR_RAMP_SPREAD_PAD;
+
+static void
+init(void)
+{
+ static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH};
+ static const VGfloat sqrCoords[5] = {0.0f, 0.0f, 400.0f, 400.0f, 0.0f};
+
+ VGfloat rampStop[] = {0.00f, 1.0f, 1.0f, 1.0f, 1.0f,
+ 0.33f, 1.0f, 0.0f, 0.0f, 1.0f,
+ 0.66f, 0.0f, 1.0f, 0.0f, 1.0f,
+ 1.00f, 0.0f, 0.0f, 1.0f, 1.0f};
+ VGfloat linearGradient[4] = {100.0f, 100.0f, 300.0f, 300.0f};
+
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0,
+ VG_PATH_CAPABILITY_APPEND_TO);
+ vgAppendPathData(path, 5, sqrCmds, sqrCoords);
+
+ fill = vgCreatePaint();
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_LINEAR_GRADIENT);
+ vgSetParameteri(fill, VG_PAINT_COLOR_RAMP_SPREAD_MODE, spread);
+ vgSetParameterfv(fill, VG_PAINT_LINEAR_GRADIENT, 4, linearGradient);
+ vgSetParameterfv(fill, VG_PAINT_COLOR_RAMP_STOPS, 20, rampStop);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, white_color);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+
+ vgDrawPath(path, VG_FILL_PATH);
+
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ if (argc > 1) {
+ const char *arg = argv[1];
+ if (!strcmp("-pad", arg))
+ spread = VG_COLOR_RAMP_SPREAD_PAD;
+ else if (!strcmp("-repeat", arg))
+ spread = VG_COLOR_RAMP_SPREAD_REPEAT;
+ else if (!strcmp("-reflect", arg))
+ spread = VG_COLOR_RAMP_SPREAD_REFLECT;
+ }
+
+ switch(spread) {
+ case VG_COLOR_RAMP_SPREAD_PAD:
+ printf("Using spread mode: pad\n");
+ break;
+ case VG_COLOR_RAMP_SPREAD_REPEAT:
+ printf("Using spread mode: repeat\n");
+ break;
+ case VG_COLOR_RAMP_SPREAD_REFLECT:
+ printf("Using spread mode: reflect\n");
+ }
+
+ set_window_size(400, 400);
+
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/lookup.c b/progs/openvg/trivial/lookup.c
new file mode 100644
index 00000000000..a103ba44888
--- /dev/null
+++ b/progs/openvg/trivial/lookup.c
@@ -0,0 +1,71 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+#include <math.h>
+#include <stdlib.h>
+#include <stdio.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {1.0, 1.0, 1.0, 0.5};
+VGfloat clearColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */
+VGImage parent;
+
+VGPaint fill;
+
+static void
+init(void)
+{
+ VGImage child1, child2;
+ VGubyte *data;
+ VGuint LUT[256];
+ VGint i;
+
+ data = (VGubyte *)malloc(sizeof(VGubyte)*window_width()*window_height());
+
+ for (i=0;i<window_width()*window_height();i++) {
+ data[i] = 0x00;
+ }
+
+ for (i=0; i<256; i++) {
+ if ( i == 0 )
+ LUT[0] = 0xFFFFFFFF;
+ else
+ LUT[i] = 0xFF00FFFF;
+ }
+
+ parent = vgCreateImage( VG_A_8, 64, 64, VG_IMAGE_QUALITY_NONANTIALIASED );
+
+ vgImageSubData(parent, data, window_width(), VG_A_8, 0, 0,
+ window_width(), window_height());
+ child1 = vgChildImage(parent, 0, 0, 32, 64);
+ child2 = vgChildImage(parent, 32, 0, 32, 64);
+
+ vgLookupSingle(child2, child1, LUT, VG_GREEN, VG_FALSE, VG_TRUE);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+}
+
+static void
+draw(void)
+{
+ vgSetfv(VG_CLEAR_COLOR, 4, clearColor);
+ vgClear(0, 0, window_width(), window_height());
+ //vgSeti(VG_MATRIX_MODE, VG_MATRIX_IMAGE_USER_TO_SURFACE);
+ //vgLoadIdentity();
+ //vgTranslate(10, 10);
+ vgDrawImage(parent);
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ set_window_size(64, 64);
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/mask.c b/progs/openvg/trivial/mask.c
new file mode 100644
index 00000000000..e5c00c56996
--- /dev/null
+++ b/progs/openvg/trivial/mask.c
@@ -0,0 +1,58 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0};
+
+VGPath path;
+VGPaint fill;
+
+
+static void
+init(void)
+{
+ static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH};
+ static const VGfloat sqrCoords[5] = {50.0f, 50.0f, 250.0f, 250.0f, 50.0f};
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0,
+ VG_PATH_CAPABILITY_APPEND_TO);
+ vgAppendPathData(path, 5, sqrCmds, sqrCoords);
+
+ fill = vgCreatePaint();
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color);
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, white_color);
+ vgSetf(VG_STROKE_LINE_WIDTH, 10);
+ vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT);
+ vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND);
+ vgSetf(VG_STROKE_MITER_LIMIT, 4.0f);
+
+ vgSeti(VG_MASKING, VG_TRUE);
+
+ vgMask(VG_INVALID_HANDLE, VG_CLEAR_MASK,
+ 25, 25, 100, 100);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+ vgDrawPath(path, VG_FILL_PATH);
+
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/mask4.c b/progs/openvg/trivial/mask4.c
new file mode 100644
index 00000000000..fe6db39648c
--- /dev/null
+++ b/progs/openvg/trivial/mask4.c
@@ -0,0 +1,132 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+#include <VG/vgu.h>
+#include <stdio.h>
+#include <math.h>
+#include <stdlib.h>
+
+#include <X11/keysym.h>
+
+//VGint x_pos = -10, y_pos = -10;
+VGint x_pos = 0, y_pos = 4;
+VGint img_width = 120, img_height = 120;
+
+static void RectToPath(VGPath path, VGfloat x, VGfloat y, VGfloat width, VGfloat height)
+{
+ static const VGubyte segments[5] = {VG_MOVE_TO_ABS,
+ VG_HLINE_TO_ABS,
+ VG_VLINE_TO_ABS,
+ VG_HLINE_TO_ABS,
+ VG_CLOSE_PATH};
+ VGfloat data[5];
+
+ data[0] = x;
+ data[1] = y;
+ data[2] = x + width;
+ data[3] = y + height;
+ data[4] = x;
+
+ vgAppendPathData(path, 5, segments, data);
+}
+
+static void
+init(void)
+{
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+}
+
+int key_press(unsigned key)
+{
+ switch(key) {
+ case XK_Right:
+ x_pos +=1;
+ break;
+ case XK_Left:
+ x_pos -=1;
+ break;
+ case XK_Up:
+ y_pos +=1;
+ break;
+ case XK_Down:
+ y_pos -=1;
+ break;
+ case 'a':
+ img_width -= 5;
+ img_height -= 5;
+ break;
+ case 's':
+ img_width += 5;
+ img_height += 5;
+ break;
+ default:
+ break;
+ }
+ fprintf(stderr, "Posi = %dx%d\n", x_pos, y_pos);
+ fprintf(stderr, "Size = %dx%d\n", img_width, img_height);
+ return VG_FALSE;
+}
+
+static void
+draw(void)
+{
+ VGint WINDSIZEX = window_width();
+ VGint WINDSIZEY = window_height();
+
+ VGPaint fill;
+ VGPath box;
+ VGfloat color[4] = {1.f, 0.f, 0.f, 1.f};
+ VGfloat bgCol[4] = {0.7f, 0.7f, 0.7f, 1.0f};
+ VGfloat transCol[4] = {0.f, 0.f, 0.f, 0.f};
+ VGImage image = vgCreateImage(VG_sRGBA_8888, img_width, img_height,
+ VG_IMAGE_QUALITY_NONANTIALIASED);
+
+ /* Background clear */
+ fill = vgCreatePaint();
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color);
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ box = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F,
+ 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL);
+ /* Rectangle to cover completely 16x16 pixel area. */
+ RectToPath(box, 0, 0, 64, 64);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, transCol);
+ vgClearImage(image, 0, 0, img_width, img_height);
+ vgSetfv(VG_CLEAR_COLOR, 4, color);
+ vgClearImage(image, 10, 10, 12, 12);
+ //vgImageSubData(image, pukki_64x64_data, pukki_64x64_stride,
+ // VG_sRGBA_8888, 0, 0, 32, 32);
+ vgSeti(VG_MASKING, VG_TRUE);
+ vgLoadIdentity();
+
+ vgSetfv(VG_CLEAR_COLOR, 4, bgCol);
+ vgClear(0, 0, WINDSIZEX, WINDSIZEY);
+
+
+ vgMask(image, VG_FILL_MASK, 0, 0, window_width(), window_height());
+ vgMask(image, VG_SET_MASK, x_pos, y_pos, 100, 100);
+
+ vgDrawPath(box, VG_FILL_PATH);
+
+ //vgSeti(VG_MATRIX_MODE, VG_MATRIX_IMAGE_USER_TO_SURFACE);
+ //vgTranslate(-10, -10);
+ //vgDrawImage(image);
+
+
+ vgDestroyPaint(fill);
+ vgDestroyPath(box);
+}
+
+
+int main(int argc, char **argv)
+{
+ set_window_size(64, 64);
+ return run(argc, argv, init, reshape,
+ draw, key_press);
+}
diff --git a/progs/openvg/trivial/path3.c b/progs/openvg/trivial/path3.c
new file mode 100644
index 00000000000..5ce600f65aa
--- /dev/null
+++ b/progs/openvg/trivial/path3.c
@@ -0,0 +1,77 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+#include <VG/vgu.h>
+#include <stdio.h>
+#include <math.h>
+#include <stdlib.h>
+
+static void
+init(void)
+{
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+}
+
+
+static void
+draw(void)
+{
+ VGint WINDSIZEX = window_width();
+ VGint WINDSIZEY = window_height();
+ VGPath path;
+ VGPaint paint;
+
+ VGfloat clearColor[] = {1.0f, 1.0f, 1.0f, 0.0f};/* white color */
+ VGfloat fillColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */
+
+#if 1
+ VGubyte commands[4] = {VG_MOVE_TO_ABS, VG_LCWARC_TO_ABS, VG_SCWARC_TO_ABS, VG_CLOSE_PATH};
+#else
+ VGubyte commands[4] = {VG_MOVE_TO_ABS, VG_SCCWARC_TO_ABS, VG_LCCWARC_TO_ABS,VG_CLOSE_PATH};
+#endif
+ VGfloat coords[] = {32.0f, 0.0f,
+ -32.0f, -32.0f, 0.0f, 64.0f, 32.0f,
+ -32.0f, -32.0f, 0.0f, 32.0f, 0.0f};
+
+
+ vgSetfv(VG_CLEAR_COLOR, 4, clearColor);
+ vgClear(0, 0, WINDSIZEX, WINDSIZEY);
+ vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED);
+
+ vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE);
+ vgLoadIdentity();
+ //vgTranslate(32.0f, 32.0f);
+
+ path = vgCreatePath( VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F,
+ 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL );
+ if ( path == VG_INVALID_HANDLE ) {
+ return;
+ }
+ paint = vgCreatePaint();
+ if ( paint == VG_INVALID_HANDLE ) {
+ vgDestroyPath(path);
+ return;
+ }
+
+ vgAppendPathData(path, 4, commands, coords);
+ vgSetParameterfv(paint, VG_PAINT_COLOR, 4, fillColor);
+ vgSetParameteri( paint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR);
+ vgSetPaint(paint, VG_FILL_PATH);
+ vgDrawPath(path, VG_FILL_PATH);
+
+ vgDestroyPath(path);
+ vgDestroyPaint(paint);
+}
+
+
+int main(int argc, char **argv)
+{
+ set_window_size(64, 64);
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/radialgrad.c b/progs/openvg/trivial/radialgrad.c
new file mode 100644
index 00000000000..cf3b1d522de
--- /dev/null
+++ b/progs/openvg/trivial/radialgrad.c
@@ -0,0 +1,99 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+#include <stdio.h>
+#include <string.h>
+
+static const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+
+static VGPath path;
+static VGPaint fill;
+
+
+VGfloat centeredGradient[5] = {200.0f, 200.0f, 200.0f, 200.0f, 100};
+VGfloat noncenteredGradient[5] = {200.0f, 200.0f, 250.0f, 250.0f, 100};
+VGfloat *radialGradient = centeredGradient;
+
+VGColorRampSpreadMode spread = VG_COLOR_RAMP_SPREAD_PAD;
+
+static void
+init(void)
+{
+ static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH};
+ static const VGfloat sqrCoords[5] = {0.0f, 0.0f, 400.0f, 400.0f, 0.0f};
+
+ VGfloat rampStop[] = {0.00f, 1.0f, 1.0f, 1.0f, 1.0f,
+ 0.33f, 1.0f, 0.0f, 0.0f, 1.0f,
+ 0.66f, 0.0f, 1.0f, 0.0f, 1.0f,
+ 1.00f, 0.0f, 0.0f, 1.0f, 1.0f};
+
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0,
+ VG_PATH_CAPABILITY_APPEND_TO);
+ vgAppendPathData(path, 5, sqrCmds, sqrCoords);
+
+ fill = vgCreatePaint();
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_RADIAL_GRADIENT);
+ vgSetParameteri(fill, VG_PAINT_COLOR_RAMP_SPREAD_MODE, spread);
+ vgSetParameterfv(fill, VG_PAINT_RADIAL_GRADIENT, 5, radialGradient);
+ vgSetParameterfv(fill, VG_PAINT_COLOR_RAMP_STOPS, 20, rampStop);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, white_color);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+
+ vgDrawPath(path, VG_FILL_PATH);
+
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ VGint i;
+ for (i = 1; i < argc; ++i) {
+ const char *arg = argv[i];
+ if (!strcmp("-pad", arg))
+ spread = VG_COLOR_RAMP_SPREAD_PAD;
+ else if (!strcmp("-repeat", arg))
+ spread = VG_COLOR_RAMP_SPREAD_REPEAT;
+ else if (!strcmp("-reflect", arg))
+ spread = VG_COLOR_RAMP_SPREAD_REFLECT;
+ else if (!strcmp("-center", arg)) {
+ printf("Centered radial gradient\n");
+ radialGradient = centeredGradient;
+ } else if (!strcmp("-noncenter", arg)) {
+ printf("Non centered radial gradient\n");
+ radialGradient = noncenteredGradient;
+ }
+ }
+
+ switch(spread) {
+ case VG_COLOR_RAMP_SPREAD_PAD:
+ printf("Using spread mode: pad\n");
+ break;
+ case VG_COLOR_RAMP_SPREAD_REPEAT:
+ printf("Using spread mode: repeat\n");
+ break;
+ case VG_COLOR_RAMP_SPREAD_REFLECT:
+ printf("Using spread mode: reflect\n");
+ }
+
+ set_window_size(400, 400);
+
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/readpixels.c b/progs/openvg/trivial/readpixels.c
new file mode 100644
index 00000000000..c8e286db9ab
--- /dev/null
+++ b/progs/openvg/trivial/readpixels.c
@@ -0,0 +1,75 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+#include <assert.h>
+
+float red_color[4] = {1.0, 0.0, 0.0, 1.0};
+float blue_color[4] = {0.0, 0.0, 1.0, 1.0};
+VGint *data;
+
+static void
+init(void)
+{
+ data = malloc(sizeof(VGint)*2048*2048);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ static const VGint red_pixel = 255 << 24 | 255 << 16 | 0 << 8 | 0;
+ static const VGint blue_pixel = 255 << 24 | 0 << 16 | 0 << 8 | 255;
+ VGint i;
+
+ vgSetfv(VG_CLEAR_COLOR, 4, red_color);
+ vgClear(0, 0, window_width(), window_height());
+ vgFlush();
+
+ memset(data, 0, window_width() * window_height() * sizeof(VGint));
+
+ vgReadPixels(data, window_width() * sizeof(VGint),
+ VG_lARGB_8888,
+ 0, 0, window_width(), window_height());
+
+ fprintf(stderr, "Red 0 = 0x%x and at 600 = 0x%x\n",
+ data[0], data[600]);
+ for (i = 0; i < window_width() * window_height(); ++i) {
+ assert(data[i] == red_pixel);
+ }
+
+ vgSetfv(VG_CLEAR_COLOR, 4, blue_color);
+ vgClear(50, 50, 50, 50);
+ vgFlush();
+
+ memset(data, 0, window_width() * window_height() * sizeof(VGint));
+
+ vgReadPixels(data, 50 * sizeof(VGint),
+ VG_lARGB_8888,
+ 50, 50, 50, 50);
+
+ fprintf(stderr, "Blue 0 = 0x%x and at 100 = 0x%x\n",
+ data[0], data[100]);
+ for (i = 0; i < 50 * 50; ++i) {
+ assert(data[i] == blue_pixel);
+ }
+}
+
+
+int main(int argc, char **argv)
+{
+ int ret = run(argc, argv, init, reshape,
+ draw, 0);
+
+ free(data);
+ return ret;
+}
diff --git a/progs/openvg/trivial/roundedrect.c b/progs/openvg/trivial/roundedrect.c
new file mode 100644
index 00000000000..c80a4ed2995
--- /dev/null
+++ b/progs/openvg/trivial/roundedrect.c
@@ -0,0 +1,67 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {0.9, 0.1, 0.1, 0.8};
+
+VGPath path;
+VGPaint fill;
+
+
+static void
+init(void)
+{
+ static const VGubyte sqrCmds[10] = {VG_MOVE_TO_ABS,
+ VG_LINE_TO_ABS,
+ VG_CUBIC_TO_ABS,
+ VG_LINE_TO_ABS,
+ VG_CUBIC_TO_ABS,
+ VG_LINE_TO_ABS,
+ VG_CUBIC_TO_ABS,
+ VG_LINE_TO_ABS,
+ VG_CUBIC_TO_ABS,
+ VG_CLOSE_PATH};
+ static const VGfloat sqrCoords[] = {
+ 45.885571, 62.857143,
+ 154.11442, 62.857143,
+ 162.1236, 62.857143, 168.57142, 70.260744, 168.57142, 79.457144,
+ 168.57142, 123.4,
+ 168.57142, 132.5964, 162.1236, 140, 154.11442, 140,
+ 45.885571, 140,
+ 37.876394, 140, 31.428572, 132.5964, 31.428572, 123.4,
+ 31.428572, 79.457144,
+ 31.428572, 70.260744, 37.876394,62.857143, 45.885571,62.857143
+ };
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0,
+ VG_PATH_CAPABILITY_APPEND_TO);
+ vgAppendPathData(path, 10, sqrCmds, sqrCoords);
+
+ fill = vgCreatePaint();
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color);
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, white_color);
+ vgSetf(VG_STROKE_LINE_WIDTH, 6);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+ vgDrawPath(path, VG_STROKE_PATH);
+}
+
+
+int main(int argc, char **argv)
+{
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/star-nonzero.c b/progs/openvg/trivial/star-nonzero.c
new file mode 100644
index 00000000000..012fbd39294
--- /dev/null
+++ b/progs/openvg/trivial/star-nonzero.c
@@ -0,0 +1,55 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat green_color[4] = {0.0, 1.0, 0.0, 0.8};
+
+VGPath path;
+VGPaint fill;
+
+
+static void
+init(void)
+{
+ static const VGubyte cmds[6] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS,
+ VG_LINE_TO_ABS, VG_CLOSE_PATH};
+ static const VGfloat coords[] = { 0, 200,
+ 300, 200,
+ 50, 0,
+ 150, 300,
+ 250, 0};
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0,
+ VG_PATH_CAPABILITY_APPEND_TO);
+ vgAppendPathData(path, 6, cmds, coords);
+
+ fill = vgCreatePaint();
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, green_color);
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, white_color);
+ vgSeti(VG_FILL_RULE, VG_NON_ZERO);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+ vgDrawPath(path, VG_FILL_PATH | VG_STROKE_PATH);
+
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/star-oddeven.c b/progs/openvg/trivial/star-oddeven.c
new file mode 100644
index 00000000000..17311cf720a
--- /dev/null
+++ b/progs/openvg/trivial/star-oddeven.c
@@ -0,0 +1,102 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat green_color[4] = {0.0, 1.0, 0.0, 0.8};
+const VGfloat black_color[4] = {0.0, 0.0, 0.0, 1.0};
+
+VGPath path;
+VGPaint fill;
+
+
+static void draw_point(VGfloat x, VGfloat y)
+{
+
+ static const VGubyte cmds[] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS,
+ VG_LINE_TO_ABS, VG_CLOSE_PATH};
+ const VGfloat coords[] = { x - 2, y - 2,
+ x + 2, y - 2,
+ x + 2, y + 2,
+ x - 2, y + 2};
+ VGPath path;
+ VGPaint fill;
+
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0,
+ VG_PATH_CAPABILITY_ALL);
+ vgAppendPathData(path, 5, cmds, coords);
+
+ fill = vgCreatePaint();
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, black_color);
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ vgDrawPath(path, VG_FILL_PATH);
+
+ vgDestroyPath(path);
+ vgDestroyPaint(fill);
+}
+
+static void draw_marks(VGPath path)
+{
+ VGfloat point[2], tangent[2];
+ int i = 0;
+
+ for (i = 0; i < 1300; i += 50) {
+ vgPointAlongPath(path, 0, 6, i,
+ point + 0, point + 1,
+ tangent + 0, tangent + 1);
+ draw_point(point[0], point[1]);
+ }
+}
+
+static void
+init(void)
+{
+ static const VGubyte cmds[6] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS,
+ VG_LINE_TO_ABS, VG_CLOSE_PATH};
+ static const VGfloat coords[] = { 0, 200,
+ 300, 200,
+ 50, 0,
+ 150, 300,
+ 250, 0};
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0,
+ VG_PATH_CAPABILITY_ALL);
+ vgAppendPathData(path, 6, cmds, coords);
+
+ fill = vgCreatePaint();
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, green_color);
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, white_color);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ VGfloat point[2], tangent[2];
+ int i = 0;
+
+ vgClear(0, 0, window_width(), window_height());
+
+ vgSetPaint(fill, VG_FILL_PATH);
+ vgDrawPath(path, VG_FILL_PATH);
+
+ draw_marks(path);
+
+
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/progs/openvg/trivial/stroke.c b/progs/openvg/trivial/stroke.c
new file mode 100644
index 00000000000..58ae5b7bc87
--- /dev/null
+++ b/progs/openvg/trivial/stroke.c
@@ -0,0 +1,116 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+#include <X11/keysym.h>
+#include <stdio.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0};
+
+VGPath path;
+VGPaint fill;
+
+VGint cap_style = VG_CAP_BUTT;
+VGint join_style = VG_JOIN_MITER;
+
+static void
+init(void)
+{
+#if 0
+ static const VGubyte cmds[] = {VG_MOVE_TO_ABS,
+ VG_CUBIC_TO_ABS,
+ };
+ static const VGfloat coords[] = {30, 30, 264, 0, 0, 264, 234, 234
+ };
+#else
+ static const VGubyte cmds[] = {VG_MOVE_TO_ABS,
+ VG_LINE_TO_ABS,
+ VG_LINE_TO_ABS
+ };
+ static const VGfloat coords[] = {30, 30, 202, 30, 150, 224
+ };
+#endif
+ VGfloat dash_pattern[2] = { 20.f, 20.f };
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0,
+ VG_PATH_CAPABILITY_APPEND_TO);
+ vgAppendPathData(path, 3, cmds, coords);
+
+ fill = vgCreatePaint();
+ vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color);
+ vgSetPaint(fill, VG_FILL_PATH);
+
+ vgSetfv(VG_CLEAR_COLOR, 4, white_color);
+ vgSetf(VG_STROKE_LINE_WIDTH, 20);
+ vgSeti(VG_STROKE_CAP_STYLE, cap_style);
+ vgSeti(VG_STROKE_JOIN_STYLE, join_style);
+ vgSetfv(VG_STROKE_DASH_PATTERN, 2, dash_pattern);
+ vgSetf(VG_STROKE_DASH_PHASE, 0.0f);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+ vgDrawPath(path, VG_STROKE_PATH);
+
+ vgFlush();
+}
+
+static int key_press(unsigned key)
+{
+ switch(key) {
+ case XK_c:
+ case XK_C:
+ ++cap_style;
+ if (cap_style > VG_CAP_SQUARE)
+ cap_style = VG_CAP_BUTT;
+ switch(cap_style) {
+ case VG_CAP_BUTT:
+ fprintf(stderr, "Cap style 'butt'\n");
+ break;
+ case VG_CAP_ROUND:
+ fprintf(stderr, "Cap style 'round'\n");
+ break;
+ case VG_CAP_SQUARE:
+ fprintf(stderr, "Cap style 'square'\n");
+ break;
+ }
+ vgSeti(VG_STROKE_CAP_STYLE, cap_style);
+ break;
+ case XK_j:
+ case XK_J:
+ ++join_style;
+ if (join_style > VG_JOIN_BEVEL)
+ join_style = VG_JOIN_MITER;
+ switch(join_style) {
+ case VG_JOIN_MITER:
+ fprintf(stderr, "Join style 'miter'\n");
+ break;
+ case VG_JOIN_ROUND:
+ fprintf(stderr, "Join style 'round'\n");
+ break;
+ case VG_JOIN_BEVEL:
+ fprintf(stderr, "Join style 'bevel'\n");
+ break;
+ }
+ vgSeti(VG_STROKE_JOIN_STYLE, join_style);
+ break;
+ default:
+ break;
+ }
+
+ return VG_TRUE;
+}
+
+int main(int argc, char **argv)
+{
+ return run(argc, argv, init, reshape,
+ draw, key_press);
+}
diff --git a/progs/openvg/trivial/stroke2.c b/progs/openvg/trivial/stroke2.c
new file mode 100644
index 00000000000..ce950c1886c
--- /dev/null
+++ b/progs/openvg/trivial/stroke2.c
@@ -0,0 +1,207 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+#include <X11/keysym.h>
+#include <stdio.h>
+
+VGPaint stroke;
+VGPath target;
+VGPath lines;
+
+VGfloat xform[9];
+VGfloat color1[4];
+VGfloat color2[4];
+VGfloat bgCol[4];
+
+static void
+init(void)
+{
+ VGubyte lineCmds[6];
+ VGfloat lineCoords[8];
+ VGfloat arcCoords[5];
+ VGubyte sccCmd[1];
+ VGubyte scCmd[1];
+ VGubyte lccCmd[1];
+ VGubyte lcCmd[1];
+ VGubyte moveCmd[1];
+ VGfloat moveCoords[2];
+ VGint i;
+
+ bgCol[0] = 1.0f;
+ bgCol[1] = 1.0f;
+ bgCol[2] = 1.0f;
+ bgCol[3] = 1.0f;
+
+ vgSetfv(VG_CLEAR_COLOR, 4, bgCol);
+ vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED);
+
+ stroke = vgCreatePaint();
+ /* Red */
+ color1[0] = 1.0f;
+ color1[1] = 0.0f;
+ color1[2] = 0.0f;
+ color1[3] = 1.0f;
+
+ /* Orange */
+ color2[0] = 1.0000f;
+ color2[1] = 1.0f;
+ color2[2] = 0.0f;
+ color2[3] = 1.0f;
+ vgSetPaint(stroke, VG_STROKE_PATH);
+
+ vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_SQUARE);
+
+ {
+ VGfloat temp[9] = {0, 0, 0, 0, 0, 0, 0, 0, 0};
+ for (i = 0; i < 9; i++)
+ {
+ xform[i] = temp[i];
+ }
+ }
+ vgGetMatrix(xform);
+
+ target = vgCreatePath(VG_PATH_FORMAT_STANDARD,
+ VG_PATH_DATATYPE_F, 1, 0, 0, 0, VG_PATH_CAPABILITY_TRANSFORM_TO);
+
+#if 0
+ /* Line path */
+ {
+ VGubyte temp[6] = {VG_MOVE_TO_ABS, VG_VLINE_TO_REL,
+ VG_MOVE_TO_ABS, VG_VLINE_TO_REL,
+ VG_HLINE_TO_REL, VG_VLINE_TO_REL};
+ for (i = 0; i < 6; i++)
+ {
+ lineCmds[i] = temp[i];
+ }
+ }
+ {
+ VGfloat temp[8] = {0.5f, 0.8f, -0.6f, 0.28f, 0.6f, -0.4f, 0.44f, 0.4f};
+ for (i = 0; i < 8; i++)
+ {
+ lineCoords[i] = temp[i] * window_width();
+ }
+ }
+#else
+ {
+ VGfloat temp[5] = {0.35f, 0.15f, 29, 0.3f, 0.4f};
+ for (i = 0; i < 5; i++)
+ {
+ arcCoords[i] = temp[i] * window_width();
+ }
+ arcCoords[2] = 29;
+ }
+
+ {
+ VGubyte temp[1] = {VG_SCCWARC_TO_ABS};
+ for (i = 0; i < 1; i++)
+ {
+ sccCmd[i] = temp[i];
+ }
+ }
+ {
+ VGubyte temp[1] = {VG_SCWARC_TO_ABS};
+ for (i = 0; i < 1; i++)
+ {
+ scCmd[i] = temp[i];
+ }
+ }
+ {
+ VGubyte temp[1] = {VG_LCCWARC_TO_ABS};
+ for (i = 0; i < 1; i++)
+ {
+ lccCmd[i] = temp[i];
+ }
+ }
+ {
+ VGubyte temp[1] = {VG_LCWARC_TO_ABS};
+ for (i = 0; i < 1; i++)
+ {
+ lcCmd[i] = temp[i];
+ }
+ }
+
+ {
+ VGubyte temp[1] = {VG_MOVE_TO_ABS};
+ for (i = 0; i < 1; i++)
+ {
+ moveCmd[i] = temp[i];
+ }
+ }
+ {
+ VGfloat temp[2] = {0.7f, 0.6f};
+ for (i = 0; i < 2; i++)
+ {
+ moveCoords[i] = temp[i] * window_width();
+ }
+ }
+#endif
+
+ lines = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1,
+ 0, 0, 0,
+ VG_PATH_CAPABILITY_APPEND_TO|
+ VG_PATH_CAPABILITY_TRANSFORM_FROM);
+#if 0
+ vgAppendPathData(lines, 6, lineCmds, lineCoords);
+#else
+ vgAppendPathData(lines, 1, moveCmd, moveCoords);
+ vgAppendPathData(lines, 1, sccCmd, arcCoords);
+ vgAppendPathData(lines, 1, moveCmd, moveCoords);
+ vgAppendPathData(lines, 1, scCmd, arcCoords);
+ vgAppendPathData(lines, 1, moveCmd, moveCoords);
+ vgAppendPathData(lines, 1, lccCmd, arcCoords);
+ vgAppendPathData(lines, 1, moveCmd, moveCoords);
+ vgAppendPathData(lines, 1, lcCmd, arcCoords);
+#endif
+
+ vgLoadIdentity();
+ vgTranslate(0.25f * window_width(), 0.25f * window_height());
+ vgRotate(30);
+ vgTranslate(-0.25f * window_width(), -0.25f * window_height());
+ vgTransformPath(target, lines);}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+ vgLoadMatrix(xform);
+ vgLoadIdentity();
+ vgTranslate(0.25f * window_width(), 0.25f * window_height());
+ vgRotate(30);
+ vgTranslate(-0.25f * window_width(), -0.25f * window_height());
+ vgSetf(VG_STROKE_LINE_WIDTH, 7);
+ vgSetParameterfv(stroke, VG_PAINT_COLOR, 4, color1);
+ vgDrawPath(lines, VG_STROKE_PATH);
+
+ vgLoadMatrix(xform);
+ vgSetParameterfv(stroke, VG_PAINT_COLOR, 4, color2);
+ vgSetf(VG_STROKE_LINE_WIDTH, 3);
+ vgDrawPath(target, VG_STROKE_PATH);
+}
+
+static int key_press(unsigned key)
+{
+ switch(key) {
+ case XK_c:
+ case XK_C:
+ break;
+ case XK_j:
+ case XK_J:
+ break;
+ default:
+ break;
+ }
+
+ return VG_TRUE;
+}
+
+int main(int argc, char **argv)
+{
+ return run(argc, argv, init, reshape,
+ draw, key_press);
+}
diff --git a/progs/openvg/trivial/vguarc.c b/progs/openvg/trivial/vguarc.c
new file mode 100644
index 00000000000..8d971d5c09c
--- /dev/null
+++ b/progs/openvg/trivial/vguarc.c
@@ -0,0 +1,74 @@
+#include "eglcommon.h"
+
+#include <VG/openvg.h>
+#include <VG/vgu.h>
+
+const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0};
+const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0};
+
+VGPath path;
+VGPaint paint;
+
+
+static void
+init(void)
+{
+ VGfloat clearColor[] = {0.0f, 0.0f, 0.0f, 1.0f};/* black color */
+ VGfloat greenColor[] = {0.0f, 1.0f, 0.0f, 1.0f};/* green color */
+ VGint arcType = VGU_ARC_OPEN;
+ VGfloat x, y, w, h, startAngle, angleExtent;
+
+ x = 150;
+ y = 150;
+ w = 150;
+ h = 150;
+#if 0
+ startAngle = -540.0f;
+ angleExtent = 270.0f;
+#else
+ startAngle = 270.0f;
+ angleExtent = 90.0f;
+#endif
+
+ paint = vgCreatePaint();
+
+ vgSetPaint(paint, VG_STROKE_PATH);
+ vgSetParameterfv(paint, VG_PAINT_COLOR, 4, greenColor);
+ vgSetParameteri( paint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR);
+ vgSetf(VG_STROKE_LINE_WIDTH, 6.0f);
+ vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED);
+ vgSetfv(VG_CLEAR_COLOR, 4, clearColor);
+
+ path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F,
+ 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL);
+
+ vguArc(path, x, y, w, h, startAngle, angleExtent, arcType);
+
+ vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT);
+ vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_BEVEL);
+ vgSetf(VG_STROKE_MITER_LIMIT, 4.0f);
+}
+
+/* new window size or exposure */
+static void
+reshape(int w, int h)
+{
+ vgLoadIdentity();
+}
+
+static void
+draw(void)
+{
+ vgClear(0, 0, window_width(), window_height());
+ vgDrawPath(path, VG_STROKE_PATH);
+
+ vgFlush();
+}
+
+
+int main(int argc, char **argv)
+{
+ // set_window_size(64, 63);
+ return run(argc, argv, init, reshape,
+ draw, 0);
+}
diff --git a/src/gallium/state_trackers/vega/Makefile b/src/gallium/state_trackers/vega/Makefile
new file mode 100644
index 00000000000..b8c805b06c4
--- /dev/null
+++ b/src/gallium/state_trackers/vega/Makefile
@@ -0,0 +1,128 @@
+# src/mesa/Makefile
+
+TOP = ../../../..
+include $(TOP)/configs/current
+GALLIUM = $(TOP)
+
+### Lists of source files, included by Makefiles
+
+VG_SOURCES = \
+ api_context.c \
+ api_filters.c \
+ api_images.c \
+ api_masks.c \
+ api_misc.c \
+ api_paint.c \
+ api_params.c \
+ api_path.c \
+ api_text.c \
+ api_transform.c \
+ vgu.c \
+ vg_context.c \
+ vg_state.c \
+ vg_tracker.c \
+ vg_translate.c \
+ polygon.c \
+ bezier.c \
+ path.c \
+ paint.c \
+ arc.c \
+ image.c \
+ renderer.c \
+ stroker.c \
+ mask.c \
+ shader.c \
+ shaders_cache.c
+
+
+### All the core C sources
+
+ALL_SOURCES = \
+ $(VG_SOURCES)
+
+
+### Object files
+VG_OBJECTS = \
+ $(VG_SOURCES:.c=.o)
+
+### Include directories
+
+INCLUDE_DIRS = \
+ -I$(TOP)/include \
+ -I$(GALLIUM)/include \
+ -I$(GALLIUM)/src/gallium/include \
+ -I$(GALLIUM)/src/gallium/auxiliary
+
+VG_LIB = OpenVG
+VG_LIB_NAME = lib$(VG_LIB).so
+
+VG_MAJOR = 1
+VG_MINOR = 0
+VG_TINY = 0
+
+GALLIUM_LIBS = \
+ $(GALLIUM)/src/gallium/auxiliary/pipebuffer/libpipebuffer.a \
+ $(GALLIUM)/src/gallium/auxiliary/sct/libsct.a \
+ $(GALLIUM)/src/gallium/auxiliary/draw/libdraw.a \
+ $(GALLIUM)/src/gallium/auxiliary/rtasm/librtasm.a \
+ $(GALLIUM)/src/gallium/auxiliary/translate/libtranslate.a \
+ $(GALLIUM)/src/gallium/auxiliary/cso_cache/libcso_cache.a \
+ $(GALLIUM)/src/gallium/auxiliary/util/libutil.a \
+ $(GALLIUM)/src/gallium/auxiliary/tgsi/libtgsi.a
+
+.SUFFIXES : .cpp
+
+.c.o:
+ $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@
+
+.cpp.o:
+ $(CXX) -c $(INCLUDE_DIRS) $(CXXFLAGS) $< -o $@
+
+.S.o:
+ $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@
+
+
+default: depend subdirs $(TOP)/$(LIB_DIR)/$(VG_LIB_NAME)
+
+# Make the OpenVG library
+$(TOP)/$(LIB_DIR)/$(VG_LIB_NAME): $(VG_OBJECTS) $(GALLIUM_LIBS)
+ $(TOP)/bin/mklib -o $(VG_LIB) \
+ -major $(VG_MAJOR) \
+ -minor $(VG_MINOR) \
+ -patch $(VG_TINY) \
+ -install $(TOP)/$(LIB_DIR) \
+ $(VG_OBJECTS) $(GALLIUM_LIBS) \
+ -Wl,--whole-archive $(LIBS) -Wl,--no-whole-archive $(SYS_LIBS)
+
+######################################################################
+# Generic stuff
+
+depend: $(ALL_SOURCES)
+ @ echo "running $(MKDEP)"
+ @ rm -f depend # workaround oops on gutsy?!?
+ @ touch depend
+ @ $(MKDEP) $(MKDEP_OPTIONS) $(DEFINES) $(INCLUDE_DIRS) $(ALL_SOURCES) \
+ > /dev/null 2>/dev/null
+
+
+subdirs:
+
+install: default
+ $(INSTALL) -d $(INSTALL_DIR)/include/VG
+ $(INSTALL) -d $(INSTALL_DIR)/$(LIB_DIR)
+ $(INSTALL) -m 644 $(TOP)/include/VG/*.h $(INSTALL_DIR)/include/VG
+ @if [ -e $(TOP)/$(LIB_DIR)/$(VG_LIB_NAME) ]; then \
+ $(INSTALL) $(TOP)/$(LIB_DIR)/libOpenVG* $(INSTALL_DIR)/$(LIB_DIR); \
+ fi
+
+# Emacs tags
+tags:
+ etags `find . -name \*.[ch]` $(TOP)/include/VG/*.h
+
+clean:
+ -rm -f *.o
+ -rm -f */*.o
+ -rm -f */*/*.o
+ -rm -f depend depend.bak
+
+include depend
diff --git a/src/gallium/state_trackers/vega/api_consts.h b/src/gallium/state_trackers/vega/api_consts.h
new file mode 100644
index 00000000000..e1b48d4a46c
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_consts.h
@@ -0,0 +1,56 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef API_CONSTS_H
+#define API_CONSTS_H
+
+/*must be at least 32*/
+#define VEGA_MAX_SCISSOR_RECTS 32
+
+/*must be at least 16*/
+#define VEGA_MAX_DASH_COUNT 32
+
+/*must be at least 7*/
+#define VEGA_MAX_KERNEL_SIZE 7
+
+/*must be at least 15*/
+#define VEGA_MAX_SEPARABLE_KERNEL_SIZE 15
+
+/*must be at least 32*/
+#define VEGA_MAX_COLOR_RAMP_STOPS 256
+
+#define VEGA_MAX_IMAGE_WIDTH 2048
+
+#define VEGA_MAX_IMAGE_HEIGHT 2048
+
+#define VEGA_MAX_IMAGE_PIXELS (2048*2048)
+
+#define VEGA_MAX_IMAGE_BYTES (2048*2048 * 4)
+
+/*must be at least 128*/
+#define VEGA_MAX_GAUSSIAN_STD_DEVIATION 128
+
+#endif
diff --git a/src/gallium/state_trackers/vega/api_context.c b/src/gallium/state_trackers/vega/api_context.c
new file mode 100644
index 00000000000..47db102dd2d
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_context.c
@@ -0,0 +1,75 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "VG/openvg.h"
+
+#include "vg_context.h"
+
+#include "pipe/p_context.h"
+#include "pipe/p_screen.h"
+
+VGErrorCode vgGetError(void)
+{
+ struct vg_context *ctx = vg_current_context();
+ VGErrorCode error = VG_NO_CONTEXT_ERROR;
+
+ if (!ctx)
+ return error;
+
+ error = ctx->_error;
+ ctx->_error = VG_NO_ERROR;
+
+ return error;
+}
+
+void vgFlush(void)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_context *pipe;
+
+ if (!ctx)
+ return;
+
+ pipe = ctx->pipe;
+ pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL);
+}
+
+void vgFinish(void)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_fence_handle *fence = NULL;
+ struct pipe_context *pipe;
+
+ if (!ctx)
+ return;
+
+ pipe = ctx->pipe;
+
+ pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE | PIPE_FLUSH_FRAME, &fence);
+
+ pipe->screen->fence_finish(pipe->screen, fence, 0);
+ pipe->screen->fence_reference(pipe->screen, &fence, NULL);
+}
diff --git a/src/gallium/state_trackers/vega/api_filters.c b/src/gallium/state_trackers/vega/api_filters.c
new file mode 100644
index 00000000000..862cbb03c43
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_filters.c
@@ -0,0 +1,805 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "VG/openvg.h"
+
+#include "vg_context.h"
+#include "image.h"
+#include "renderer.h"
+#include "shaders_cache.h"
+#include "st_inlines.h"
+
+#include "pipe/p_context.h"
+#include "pipe/p_state.h"
+#include "pipe/p_inlines.h"
+#include "pipe/p_screen.h"
+#include "pipe/p_shader_tokens.h"
+
+#include "util/u_memory.h"
+
+
+#include "asm_filters.h"
+
+
+struct filter_info {
+ struct vg_image *dst;
+ struct vg_image *src;
+ struct vg_shader * (*setup_shader)(struct vg_context *, void *);
+ void *user_data;
+ const void *const_buffer;
+ VGint const_buffer_len;
+ VGTilingMode tiling_mode;
+ struct pipe_texture *extra_texture;
+};
+
+static INLINE struct pipe_texture *create_texture_1d(struct vg_context *ctx,
+ const VGuint *color_data,
+ const VGint color_data_len)
+{
+ struct pipe_context *pipe = ctx->pipe;
+ struct pipe_screen *screen = pipe->screen;
+ struct pipe_texture *tex = 0;
+ struct pipe_texture templ;
+
+ memset(&templ, 0, sizeof(templ));
+ templ.target = PIPE_TEXTURE_1D;
+ templ.format = PIPE_FORMAT_A8R8G8B8_UNORM;
+ templ.last_level = 0;
+ templ.width[0] = color_data_len;
+ templ.height[0] = 1;
+ templ.depth[0] = 1;
+ pf_get_block(PIPE_FORMAT_A8R8G8B8_UNORM, &templ.block);
+ templ.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER;
+
+ tex = screen->texture_create(screen, &templ);
+
+ { /* upload color_data */
+ struct pipe_transfer *transfer =
+ screen->get_tex_transfer(screen, tex,
+ 0, 0, 0,
+ PIPE_TRANSFER_READ_WRITE ,
+ 0, 0, tex->width[0], tex->height[0]);
+ void *map = screen->transfer_map(screen, transfer);
+ memcpy(map, color_data, sizeof(VGint)*color_data_len);
+ screen->transfer_unmap(screen, transfer);
+ screen->tex_transfer_destroy(transfer);
+ }
+
+ return tex;
+}
+
+static INLINE struct pipe_surface * setup_framebuffer(struct vg_image *dst)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_context *pipe = ctx->pipe;
+ struct pipe_framebuffer_state fb;
+ struct pipe_surface *dst_surf = pipe->screen->get_tex_surface(
+ pipe->screen, dst->texture, 0, 0, 0,
+ PIPE_BUFFER_USAGE_GPU_WRITE);
+
+ /* drawing dest */
+ memset(&fb, 0, sizeof(fb));
+ fb.width = dst->x + dst_surf->width;
+ fb.height = dst->y + dst_surf->height;
+ fb.nr_cbufs = 1;
+ fb.cbufs[0] = dst_surf;
+ {
+ VGint i;
+ for (i = 1; i < PIPE_MAX_COLOR_BUFS; ++i)
+ fb.cbufs[i] = 0;
+ }
+ cso_set_framebuffer(ctx->cso_context, &fb);
+
+ return dst_surf;
+}
+
+static void setup_viewport(struct vg_image *dst)
+{
+ struct vg_context *ctx = vg_current_context();
+ vg_set_viewport(ctx, VEGA_Y0_TOP);
+}
+
+static void setup_blend()
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_blend_state blend;
+ memset(&blend, 0, sizeof(blend));
+ blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE;
+ blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE;
+ blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO;
+ blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO;
+ if (ctx->state.vg.filter_channel_mask & VG_RED)
+ blend.colormask |= PIPE_MASK_R;
+ if (ctx->state.vg.filter_channel_mask & VG_GREEN)
+ blend.colormask |= PIPE_MASK_G;
+ if (ctx->state.vg.filter_channel_mask & VG_BLUE)
+ blend.colormask |= PIPE_MASK_B;
+ if (ctx->state.vg.filter_channel_mask & VG_ALPHA)
+ blend.colormask |= PIPE_MASK_A;
+ blend.blend_enable = 1;
+ cso_set_blend(ctx->cso_context, &blend);
+}
+
+static void setup_constant_buffer(struct vg_context *ctx, const void *buffer,
+ VGint param_bytes)
+{
+ struct pipe_context *pipe = ctx->pipe;
+ struct pipe_constant_buffer *cbuf = &ctx->filter.buffer;
+
+ /* We always need to get a new buffer, to keep the drivers simple and
+ * avoid gratuitous rendering synchronization. */
+ pipe_buffer_reference(&cbuf->buffer, NULL);
+
+ cbuf->buffer = pipe_buffer_create(pipe->screen, 16,
+ PIPE_BUFFER_USAGE_CONSTANT,
+ param_bytes);
+
+ if (cbuf->buffer) {
+ st_no_flush_pipe_buffer_write(ctx, cbuf->buffer,
+ 0, param_bytes, buffer);
+ }
+
+ ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf);
+}
+
+static void setup_samplers(struct vg_context *ctx, struct filter_info *info)
+{
+ struct pipe_sampler_state *samplers[PIPE_MAX_SAMPLERS];
+ struct pipe_texture *textures[PIPE_MAX_SAMPLERS];
+ struct pipe_sampler_state sampler[3];
+ int num_samplers = 0;
+ int num_textures = 0;
+
+ samplers[0] = NULL;
+ samplers[1] = NULL;
+ samplers[2] = NULL;
+ samplers[3] = NULL;
+ textures[0] = NULL;
+ textures[1] = NULL;
+ textures[2] = NULL;
+ textures[3] = NULL;
+
+ memset(&sampler[0], 0, sizeof(struct pipe_sampler_state));
+ sampler[0].wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ sampler[0].wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ sampler[0].wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ sampler[0].min_img_filter = PIPE_TEX_MIPFILTER_LINEAR;
+ sampler[0].mag_img_filter = PIPE_TEX_MIPFILTER_LINEAR;
+ sampler[0].normalized_coords = 1;
+
+ switch(info->tiling_mode) {
+ case VG_TILE_FILL:
+ sampler[0].wrap_s = PIPE_TEX_WRAP_CLAMP_TO_BORDER;
+ sampler[0].wrap_t = PIPE_TEX_WRAP_CLAMP_TO_BORDER;
+ memcpy(sampler[0].border_color,
+ ctx->state.vg.tile_fill_color,
+ sizeof(VGfloat) * 4);
+ break;
+ case VG_TILE_PAD:
+ sampler[0].wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ sampler[0].wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ break;
+ case VG_TILE_REPEAT:
+ sampler[0].wrap_s = PIPE_TEX_WRAP_REPEAT;
+ sampler[0].wrap_t = PIPE_TEX_WRAP_REPEAT;
+ break;
+ case VG_TILE_REFLECT:
+ sampler[0].wrap_s = PIPE_TEX_WRAP_MIRROR_REPEAT;
+ sampler[0].wrap_t = PIPE_TEX_WRAP_MIRROR_REPEAT;
+ break;
+ default:
+ debug_assert(!"Unknown tiling mode");
+ }
+
+ samplers[0] = &sampler[0];
+ textures[0] = info->src->texture;
+ ++num_samplers;
+ ++num_textures;
+
+ if (info->extra_texture) {
+ memcpy(&sampler[1], &sampler[0], sizeof(struct pipe_sampler_state));
+ samplers[1] = &sampler[1];
+ textures[1] = info->extra_texture;
+ ++num_samplers;
+ ++num_textures;
+ }
+
+
+ cso_set_samplers(ctx->cso_context, num_samplers, (const struct pipe_sampler_state **)samplers);
+ cso_set_sampler_textures(ctx->cso_context, num_textures, textures);
+}
+
+static struct vg_shader * setup_color_matrix(struct vg_context *ctx, void *user_data)
+{
+ struct vg_shader *shader =
+ shader_create_from_text(ctx->pipe, color_matrix_asm, 200,
+ PIPE_SHADER_FRAGMENT);
+ cso_set_fragment_shader_handle(ctx->cso_context, shader->driver);
+ return shader;
+}
+
+static struct vg_shader * setup_convolution(struct vg_context *ctx, void *user_data)
+{
+ char buffer[1024];
+ VGint num_consts = (VGint)(long)(user_data);
+ struct vg_shader *shader;
+
+ snprintf(buffer, 1023, convolution_asm, num_consts, num_consts / 2 + 1);
+
+ shader = shader_create_from_text(ctx->pipe, buffer, 200,
+ PIPE_SHADER_FRAGMENT);
+
+ cso_set_fragment_shader_handle(ctx->cso_context, shader->driver);
+ return shader;
+}
+
+static struct vg_shader * setup_lookup(struct vg_context *ctx, void *user_data)
+{
+ struct vg_shader *shader =
+ shader_create_from_text(ctx->pipe, lookup_asm,
+ 200, PIPE_SHADER_FRAGMENT);
+
+ cso_set_fragment_shader_handle(ctx->cso_context, shader->driver);
+ return shader;
+}
+
+
+static struct vg_shader * setup_lookup_single(struct vg_context *ctx, void *user_data)
+{
+ char buffer[1024];
+ VGImageChannel channel = (VGImageChannel)(user_data);
+ struct vg_shader *shader;
+
+ switch(channel) {
+ case VG_RED:
+ snprintf(buffer, 1023, lookup_single_asm, "xxxx");
+ break;
+ case VG_GREEN:
+ snprintf(buffer, 1023, lookup_single_asm, "yyyy");
+ break;
+ case VG_BLUE:
+ snprintf(buffer, 1023, lookup_single_asm, "zzzz");
+ break;
+ case VG_ALPHA:
+ snprintf(buffer, 1023, lookup_single_asm, "wwww");
+ break;
+ default:
+ debug_assert(!"Unknown color channel");
+ }
+
+ shader = shader_create_from_text(ctx->pipe, buffer, 200,
+ PIPE_SHADER_FRAGMENT);
+
+ cso_set_fragment_shader_handle(ctx->cso_context, shader->driver);
+ return shader;
+}
+
+static void execute_filter(struct vg_context *ctx,
+ struct filter_info *info)
+{
+ struct pipe_surface *dst_surf;
+ struct vg_shader *shader;
+
+ cso_save_framebuffer(ctx->cso_context);
+ cso_save_fragment_shader(ctx->cso_context);
+ cso_save_viewport(ctx->cso_context);
+ cso_save_blend(ctx->cso_context);
+ cso_save_samplers(ctx->cso_context);
+ cso_save_sampler_textures(ctx->cso_context);
+
+ dst_surf = setup_framebuffer(info->dst);
+ setup_viewport(info->dst);
+ setup_blend();
+ setup_constant_buffer(ctx, info->const_buffer, info->const_buffer_len);
+ shader = info->setup_shader(ctx, info->user_data);
+ setup_samplers(ctx, info);
+
+ renderer_draw_texture(ctx->renderer,
+ info->src->texture,
+ info->dst->x, info->dst->y,
+ info->dst->x + info->dst->width,
+ info->dst->y + info->dst->height,
+ info->dst->x, info->dst->y,
+ info->dst->x + info->dst->width,
+ info->dst->y + info->dst->height);
+
+ cso_restore_framebuffer(ctx->cso_context);
+ cso_restore_fragment_shader(ctx->cso_context);
+ cso_restore_viewport(ctx->cso_context);
+ cso_restore_blend(ctx->cso_context);
+ cso_restore_samplers(ctx->cso_context);
+ cso_restore_sampler_textures(ctx->cso_context);
+
+ vg_shader_destroy(ctx, shader);
+
+ pipe_surface_reference(&dst_surf, NULL);
+}
+
+void vgColorMatrix(VGImage dst, VGImage src,
+ const VGfloat * matrix)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *d, *s;
+ struct filter_info info;
+
+ if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (!matrix || !is_aligned(matrix)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ d = (struct vg_image*)dst;
+ s = (struct vg_image*)src;
+
+ if (vg_image_overlaps(d, s)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ info.dst = d;
+ info.src = s;
+ info.setup_shader = &setup_color_matrix;
+ info.user_data = NULL;
+ info.const_buffer = matrix;
+ info.const_buffer_len = 20 * sizeof(VGfloat);
+ info.tiling_mode = VG_TILE_PAD;
+ info.extra_texture = 0;
+ execute_filter(ctx, &info);
+}
+
+static VGfloat texture_offset(VGfloat width, VGint kernelSize, VGint current, VGint shift)
+{
+ VGfloat diff = current - shift;
+
+ return diff / width;
+}
+
+void vgConvolve(VGImage dst, VGImage src,
+ VGint kernelWidth, VGint kernelHeight,
+ VGint shiftX, VGint shiftY,
+ const VGshort * kernel,
+ VGfloat scale,
+ VGfloat bias,
+ VGTilingMode tilingMode)
+{
+ struct vg_context *ctx = vg_current_context();
+ VGfloat *buffer;
+ VGint buffer_len;
+ VGint i, j;
+ VGint idx = 0;
+ struct vg_image *d, *s;
+ VGint kernel_size = kernelWidth * kernelHeight;
+ struct filter_info info;
+ const VGint max_kernel_size = vgGeti(VG_MAX_KERNEL_SIZE);
+
+ if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (kernelWidth <= 0 || kernelHeight <= 0 ||
+ kernelWidth > max_kernel_size || kernelHeight > max_kernel_size) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (!kernel || !is_aligned_to(kernel, 2)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (tilingMode < VG_TILE_FILL ||
+ tilingMode > VG_TILE_REFLECT) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ d = (struct vg_image*)dst;
+ s = (struct vg_image*)src;
+
+ if (vg_image_overlaps(d, s)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ vg_validate_state(ctx);
+
+ buffer_len = 8 + 2 * 4 * kernel_size;
+ buffer = (VGfloat*)malloc(buffer_len * sizeof(VGfloat));
+
+ buffer[0] = 0.f;
+ buffer[1] = 1.f;
+ buffer[2] = 2.f; /*unused*/
+ buffer[3] = 4.f; /*unused*/
+
+ buffer[4] = kernelWidth * kernelHeight;
+ buffer[5] = scale;
+ buffer[6] = bias;
+ buffer[7] = 0.f;
+
+ idx = 8;
+ for (j = 0; j < kernelHeight; ++j) {
+ for (i = 0; i < kernelWidth; ++i) {
+ VGint index = j * kernelWidth + i;
+ VGfloat x, y;
+
+ x = texture_offset(s->width, kernelWidth, i, shiftX);
+ y = texture_offset(s->height, kernelHeight, j, shiftY);
+
+ buffer[idx + index*4 + 0] = x;
+ buffer[idx + index*4 + 1] = y;
+ buffer[idx + index*4 + 2] = 0.f;
+ buffer[idx + index*4 + 3] = 0.f;
+ }
+ }
+ idx += kernel_size * 4;
+
+ for (j = 0; j < kernelHeight; ++j) {
+ for (i = 0; i < kernelWidth; ++i) {
+ /* transpose the kernel */
+ VGint index = j * kernelWidth + i;
+ VGint kindex = (kernelWidth - i - 1) * kernelHeight + (kernelHeight - j - 1);
+ buffer[idx + index*4 + 0] = kernel[kindex];
+ buffer[idx + index*4 + 1] = kernel[kindex];
+ buffer[idx + index*4 + 2] = kernel[kindex];
+ buffer[idx + index*4 + 3] = kernel[kindex];
+ }
+ }
+
+ info.dst = d;
+ info.src = s;
+ info.setup_shader = &setup_convolution;
+ info.user_data = (void*)(long)(buffer_len/4);
+ info.const_buffer = buffer;
+ info.const_buffer_len = buffer_len * sizeof(VGfloat);
+ info.tiling_mode = tilingMode;
+ info.extra_texture = 0;
+ execute_filter(ctx, &info);
+
+ free(buffer);
+}
+
+void vgSeparableConvolve(VGImage dst, VGImage src,
+ VGint kernelWidth,
+ VGint kernelHeight,
+ VGint shiftX, VGint shiftY,
+ const VGshort * kernelX,
+ const VGshort * kernelY,
+ VGfloat scale,
+ VGfloat bias,
+ VGTilingMode tilingMode)
+{
+ struct vg_context *ctx = vg_current_context();
+ VGshort *kernel;
+ VGint i, j, idx = 0;
+ const VGint max_kernel_size = vgGeti(VG_MAX_SEPARABLE_KERNEL_SIZE);
+
+ if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (kernelWidth <= 0 || kernelHeight <= 0 ||
+ kernelWidth > max_kernel_size || kernelHeight > max_kernel_size) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (!kernelX || !kernelY ||
+ !is_aligned_to(kernelX, 2) || !is_aligned_to(kernelY, 2)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (tilingMode < VG_TILE_FILL ||
+ tilingMode > VG_TILE_REFLECT) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ kernel = malloc(sizeof(VGshort)*kernelWidth*kernelHeight);
+ for (i = 0; i < kernelWidth; ++i) {
+ for (j = 0; j < kernelHeight; ++j) {
+ kernel[idx] = kernelX[i] * kernelY[j];
+ ++idx;
+ }
+ }
+ vgConvolve(dst, src, kernelWidth, kernelHeight, shiftX, shiftY,
+ kernel, scale, bias, tilingMode);
+ free(kernel);
+}
+
+static INLINE VGfloat compute_gaussian_componenet(VGfloat x, VGfloat y,
+ VGfloat stdDeviationX,
+ VGfloat stdDeviationY)
+{
+ VGfloat mult = 1 / ( 2 * M_PI * stdDeviationX * stdDeviationY);
+ VGfloat e = exp( - ( pow(x, 2)/(2*pow(stdDeviationX, 2)) +
+ pow(y, 2)/(2*pow(stdDeviationY, 2)) ) );
+ return mult * e;
+}
+
+static INLINE VGint compute_kernel_size(VGfloat deviation)
+{
+ VGint size = ceil(2.146 * deviation);
+ if (size > 11)
+ return 11;
+ return size;
+}
+
+static void compute_gaussian_kernel(VGfloat *kernel,
+ VGint width, VGint height,
+ VGfloat stdDeviationX,
+ VGfloat stdDeviationY)
+{
+ VGint i, j;
+ VGfloat scale = 0.0f;
+
+ for (j = 0; j < height; ++j) {
+ for (i = 0; i < width; ++i) {
+ VGint idx = (height - j -1) * width + (width - i -1);
+ kernel[idx] = compute_gaussian_componenet(i-(ceil(width/2))-1,
+ j-ceil(height/2)-1,
+ stdDeviationX, stdDeviationY);
+ scale += kernel[idx];
+ }
+ }
+
+ for (j = 0; j < height; ++j) {
+ for (i = 0; i < width; ++i) {
+ VGint idx = j * width + i;
+ kernel[idx] /= scale;
+ }
+ }
+}
+
+void vgGaussianBlur(VGImage dst, VGImage src,
+ VGfloat stdDeviationX,
+ VGfloat stdDeviationY,
+ VGTilingMode tilingMode)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *d, *s;
+ VGfloat *buffer, *kernel;
+ VGint kernel_width, kernel_height, kernel_size;
+ VGint buffer_len;
+ VGint idx, i, j;
+ struct filter_info info;
+
+ if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (stdDeviationX <= 0 || stdDeviationY <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (tilingMode < VG_TILE_FILL ||
+ tilingMode > VG_TILE_REFLECT) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ d = (struct vg_image*)dst;
+ s = (struct vg_image*)src;
+
+ if (vg_image_overlaps(d, s)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ kernel_width = compute_kernel_size(stdDeviationX);
+ kernel_height = compute_kernel_size(stdDeviationY);
+ kernel_size = kernel_width * kernel_height;
+ kernel = malloc(sizeof(VGfloat)*kernel_size);
+ compute_gaussian_kernel(kernel, kernel_width, kernel_height,
+ stdDeviationX, stdDeviationY);
+
+ buffer_len = 8 + 2 * 4 * kernel_size;
+ buffer = (VGfloat*)malloc(buffer_len * sizeof(VGfloat));
+
+ buffer[0] = 0.f;
+ buffer[1] = 1.f;
+ buffer[2] = 2.f; /*unused*/
+ buffer[3] = 4.f; /*unused*/
+
+ buffer[4] = kernel_width * kernel_height;
+ buffer[5] = 1.f;/*scale*/
+ buffer[6] = 0.f;/*bias*/
+ buffer[7] = 0.f;
+
+ idx = 8;
+ for (j = 0; j < kernel_height; ++j) {
+ for (i = 0; i < kernel_width; ++i) {
+ VGint index = j * kernel_width + i;
+ VGfloat x, y;
+
+ x = texture_offset(s->width, kernel_width, i, kernel_width/2);
+ y = texture_offset(s->height, kernel_height, j, kernel_height/2);
+
+ buffer[idx + index*4 + 0] = x;
+ buffer[idx + index*4 + 1] = y;
+ buffer[idx + index*4 + 2] = 0.f;
+ buffer[idx + index*4 + 3] = 0.f;
+ }
+ }
+ idx += kernel_size * 4;
+
+ for (j = 0; j < kernel_height; ++j) {
+ for (i = 0; i < kernel_width; ++i) {
+ /* transpose the kernel */
+ VGint index = j * kernel_width + i;
+ VGint kindex = (kernel_width - i - 1) * kernel_height + (kernel_height - j - 1);
+ buffer[idx + index*4 + 0] = kernel[kindex];
+ buffer[idx + index*4 + 1] = kernel[kindex];
+ buffer[idx + index*4 + 2] = kernel[kindex];
+ buffer[idx + index*4 + 3] = kernel[kindex];
+ }
+ }
+
+ info.dst = d;
+ info.src = s;
+ info.setup_shader = &setup_convolution;
+ info.user_data = (void*)(long)(buffer_len/4);
+ info.const_buffer = buffer;
+ info.const_buffer_len = buffer_len * sizeof(VGfloat);
+ info.tiling_mode = tilingMode;
+ info.extra_texture = 0;
+ execute_filter(ctx, &info);
+
+ free(buffer);
+ free(kernel);
+}
+
+void vgLookup(VGImage dst, VGImage src,
+ const VGubyte * redLUT,
+ const VGubyte * greenLUT,
+ const VGubyte * blueLUT,
+ const VGubyte * alphaLUT,
+ VGboolean outputLinear,
+ VGboolean outputPremultiplied)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *d, *s;
+ VGuint color_data[256];
+ VGint i;
+ struct pipe_texture *lut_texture;
+ VGfloat buffer[4];
+ struct filter_info info;
+
+ if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (!redLUT || !greenLUT || !blueLUT || !alphaLUT) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ d = (struct vg_image*)dst;
+ s = (struct vg_image*)src;
+
+ if (vg_image_overlaps(d, s)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ for (i = 0; i < 256; ++i) {
+ color_data[i] = blueLUT[i] << 24 | greenLUT[i] << 16 |
+ redLUT[i] << 8 | alphaLUT[i];
+ }
+ lut_texture = create_texture_1d(ctx, color_data, 255);
+
+ buffer[0] = 0.f;
+ buffer[1] = 0.f;
+ buffer[2] = 1.f;
+ buffer[3] = 1.f;
+
+ info.dst = d;
+ info.src = s;
+ info.setup_shader = &setup_lookup;
+ info.user_data = NULL;
+ info.const_buffer = buffer;
+ info.const_buffer_len = 4 * sizeof(VGfloat);
+ info.tiling_mode = VG_TILE_PAD;
+ info.extra_texture = lut_texture;
+
+ execute_filter(ctx, &info);
+
+ pipe_texture_reference(&lut_texture, NULL);
+}
+
+void vgLookupSingle(VGImage dst, VGImage src,
+ const VGuint * lookupTable,
+ VGImageChannel sourceChannel,
+ VGboolean outputLinear,
+ VGboolean outputPremultiplied)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *d, *s;
+ struct pipe_texture *lut_texture;
+ VGfloat buffer[4];
+ struct filter_info info;
+ VGuint color_data[256];
+ VGint i;
+
+ if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (!lookupTable || !is_aligned(lookupTable)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (sourceChannel != VG_RED && sourceChannel != VG_GREEN &&
+ sourceChannel != VG_BLUE && sourceChannel != VG_ALPHA) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ d = (struct vg_image*)dst;
+ s = (struct vg_image*)src;
+
+ if (vg_image_overlaps(d, s)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ for (i = 0; i < 256; ++i) {
+ VGuint rgba = lookupTable[i];
+ VGubyte blue, green, red, alpha;
+ red = (rgba & 0xff000000)>>24;
+ green = (rgba & 0x00ff0000)>>16;
+ blue = (rgba & 0x0000ff00)>> 8;
+ alpha = (rgba & 0x000000ff)>> 0;
+ color_data[i] = blue << 24 | green << 16 |
+ red << 8 | alpha;
+ }
+ lut_texture = create_texture_1d(ctx, color_data, 256);
+
+ buffer[0] = 0.f;
+ buffer[1] = 0.f;
+ buffer[2] = 1.f;
+ buffer[3] = 1.f;
+
+ info.dst = d;
+ info.src = s;
+ info.setup_shader = &setup_lookup_single;
+ info.user_data = (void*)sourceChannel;
+ info.const_buffer = buffer;
+ info.const_buffer_len = 4 * sizeof(VGfloat);
+ info.tiling_mode = VG_TILE_PAD;
+ info.extra_texture = lut_texture;
+
+ execute_filter(ctx, &info);
+
+ pipe_texture_reference(&lut_texture, NULL);
+}
diff --git a/src/gallium/state_trackers/vega/api_images.c b/src/gallium/state_trackers/vega/api_images.c
new file mode 100644
index 00000000000..c437553bc23
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_images.c
@@ -0,0 +1,489 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "image.h"
+
+#include "VG/openvg.h"
+
+#include "vg_context.h"
+#include "vg_translate.h"
+#include "api_consts.h"
+#include "image.h"
+
+#include "pipe/p_context.h"
+#include "pipe/p_screen.h"
+#include "pipe/p_inlines.h"
+#include "util/u_blit.h"
+#include "util/u_tile.h"
+#include "util/u_memory.h"
+
+static INLINE VGboolean supported_image_format(VGImageFormat format)
+{
+ switch(format) {
+ case VG_sRGBX_8888:
+ case VG_sRGBA_8888:
+ case VG_sRGBA_8888_PRE:
+ case VG_sRGB_565:
+ case VG_sRGBA_5551:
+ case VG_sRGBA_4444:
+ case VG_sL_8:
+ case VG_lRGBX_8888:
+ case VG_lRGBA_8888:
+ case VG_lRGBA_8888_PRE:
+ case VG_lL_8:
+ case VG_A_8:
+ case VG_BW_1:
+#ifdef OPENVG_VERSION_1_1
+ case VG_A_1:
+ case VG_A_4:
+#endif
+ case VG_sXRGB_8888:
+ case VG_sARGB_8888:
+ case VG_sARGB_8888_PRE:
+ case VG_sARGB_1555:
+ case VG_sARGB_4444:
+ case VG_lXRGB_8888:
+ case VG_lARGB_8888:
+ case VG_lARGB_8888_PRE:
+ case VG_sBGRX_8888:
+ case VG_sBGRA_8888:
+ case VG_sBGRA_8888_PRE:
+ case VG_sBGR_565:
+ case VG_sBGRA_5551:
+ case VG_sBGRA_4444:
+ case VG_lBGRX_8888:
+ case VG_lBGRA_8888:
+ case VG_lBGRA_8888_PRE:
+ case VG_sXBGR_8888:
+ case VG_sABGR_8888:
+ case VG_sABGR_8888_PRE:
+ case VG_sABGR_1555:
+ case VG_sABGR_4444:
+ case VG_lXBGR_8888:
+ case VG_lABGR_8888:
+ case VG_lABGR_8888_PRE:
+ return VG_TRUE;
+ default:
+ return VG_FALSE;
+ }
+ return VG_FALSE;
+}
+
+VGImage vgCreateImage(VGImageFormat format,
+ VGint width, VGint height,
+ VGbitfield allowedQuality)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (!supported_image_format(format)) {
+ vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+ if (width > vgGeti(VG_MAX_IMAGE_WIDTH) ||
+ height > vgGeti(VG_MAX_IMAGE_HEIGHT)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+ if (width * height > vgGeti(VG_MAX_IMAGE_PIXELS)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+
+ if (!(allowedQuality & ((VG_IMAGE_QUALITY_NONANTIALIASED |
+ VG_IMAGE_QUALITY_FASTER |
+ VG_IMAGE_QUALITY_BETTER)))) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+
+ return (VGImage)image_create(format, width, height);
+}
+
+void vgDestroyImage(VGImage image)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *img = (struct vg_image *)image;
+
+ if (image == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (!vg_object_is_valid((void*)image, VG_OBJECT_IMAGE)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ image_destroy(img);
+}
+
+void vgClearImage(VGImage image,
+ VGint x, VGint y,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *img;
+
+ if (image == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ img = (struct vg_image*)image;
+
+ if (x + width < 0 || y + height < 0)
+ return;
+
+ image_clear(img, x, y, width, height);
+
+}
+
+void vgImageSubData(VGImage image,
+ const void * data,
+ VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint x, VGint y,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *img;
+
+ if (image == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (!supported_image_format(dataFormat)) {
+ vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR);
+ return;
+ }
+ if (width <= 0 || height <= 0 || !data || !is_aligned(data)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ img = (struct vg_image*)(image);
+ image_sub_data(img, data, dataStride, dataFormat,
+ x, y, width, height);
+}
+
+void vgGetImageSubData(VGImage image,
+ void * data,
+ VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint x, VGint y,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *img;
+
+ if (image == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (!supported_image_format(dataFormat)) {
+ vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR);
+ return;
+ }
+ if (width <= 0 || height <= 0 || !data || !is_aligned(data)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ img = (struct vg_image*)image;
+ image_get_sub_data(img, data, dataStride, dataFormat,
+ x, y, width, height);
+}
+
+VGImage vgChildImage(VGImage parent,
+ VGint x, VGint y,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *p;
+
+ if (parent == VG_INVALID_HANDLE ||
+ !vg_context_is_object_valid(ctx, VG_OBJECT_IMAGE, (void*)parent) ||
+ !vg_object_is_valid((void*)parent, VG_OBJECT_IMAGE)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+ if (width <= 0 || height <= 0 || x < 0 || y < 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+ p = (struct vg_image *)parent;
+ if (x > p->width || y > p->height) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+ if (x + width > p->width || y + height > p->height) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+
+ return (VGImage)image_child_image(p, x, y, width, height);
+}
+
+VGImage vgGetParent(VGImage image)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *img;
+
+ if (image == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+
+ img = (struct vg_image*)image;
+ if (img->parent)
+ return (VGImage)img->parent;
+ else
+ return image;
+}
+
+void vgCopyImage(VGImage dst, VGint dx, VGint dy,
+ VGImage src, VGint sx, VGint sy,
+ VGint width, VGint height,
+ VGboolean dither)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (src == VG_INVALID_HANDLE || dst == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ vg_validate_state(ctx);
+ image_copy((struct vg_image*)dst, dx, dy,
+ (struct vg_image*)src, sx, sy,
+ width, height, dither);
+}
+
+void vgDrawImage(VGImage image)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (!ctx)
+ return;
+
+ if (image == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ vg_validate_state(ctx);
+ image_draw((struct vg_image*)image);
+}
+
+void vgSetPixels(VGint dx, VGint dy,
+ VGImage src, VGint sx, VGint sy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ vg_validate_state(ctx);
+
+ if (src == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ image_set_pixels(dx, dy, (struct vg_image*)src, sx, sy, width,
+ height);
+}
+
+void vgGetPixels(VGImage dst, VGint dx, VGint dy,
+ VGint sx, VGint sy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *img;
+
+ if (dst == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ img = (struct vg_image*)dst;
+
+ image_get_pixels(img, dx, dy,
+ sx, sy, width, height);
+}
+
+void vgWritePixels(const void * data, VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint dx, VGint dy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_context *pipe = ctx->pipe;
+
+ if (!supported_image_format(dataFormat)) {
+ vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR);
+ return;
+ }
+ if (!data || !is_aligned(data)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ vg_validate_state(ctx);
+ {
+ struct vg_image *img = image_create(dataFormat, width, height);
+ image_sub_data(img, data, dataStride, dataFormat, 0, 0,
+ width, height);
+#if 0
+ struct matrix *matrix = &ctx->state.vg.image_user_to_surface_matrix;
+ matrix_translate(matrix, dx, dy);
+ image_draw(img);
+ matrix_translate(matrix, -dx, -dy);
+#else
+ /* this looks like a better approach */
+ image_set_pixels(dx, dy, img, 0, 0, width, height);
+#endif
+ image_destroy(img);
+ }
+ /* make sure rendering has completed */
+ pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL);
+}
+
+void vgReadPixels(void * data, VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint sx, VGint sy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_context *pipe = ctx->pipe;
+ struct pipe_screen *screen = pipe->screen;
+
+ struct st_framebuffer *stfb = ctx->draw_buffer;
+ struct st_renderbuffer *strb = stfb->strb;
+ struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb;
+
+ VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4];
+ VGfloat *df = (VGfloat*)temp;
+ VGint y = (fb->height - sy) - 1, yStep = -1;
+ VGint i;
+ VGubyte *dst = (VGubyte *)data;
+ VGint xoffset = 0, yoffset = 0;
+
+ if (!supported_image_format(dataFormat)) {
+ vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR);
+ return;
+ }
+ if (!data || !is_aligned(data)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ /* make sure rendering has completed */
+ pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL);
+ if (sx < 0) {
+ xoffset = -sx;
+ xoffset *= _vega_size_for_format(dataFormat);
+ width += sx;
+ sx = 0;
+ }
+ if (sy < 0) {
+ yoffset = -sy;
+ height += sy;
+ sy = 0;
+ y = (fb->height - sy) - 1;
+ yoffset *= dataStride;
+ }
+
+ {
+ struct pipe_transfer *transfer;
+
+ transfer = screen->get_tex_transfer(screen, strb->texture, 0, 0, 0,
+ PIPE_TRANSFER_READ,
+ 0, 0, width, height);
+
+ /* Do a row at a time to flip image data vertically */
+ for (i = 0; i < height; i++) {
+#if 0
+ debug_printf("%d-%d == %d\n", sy, height, y);
+#endif
+ pipe_get_tile_rgba(transfer, sx, y, width, 1, df);
+ y += yStep;
+ _vega_pack_rgba_span_float(ctx, width, temp, dataFormat,
+ dst + yoffset + xoffset);
+ dst += dataStride;
+ }
+
+ screen->tex_transfer_destroy(transfer);
+ }
+}
+
+void vgCopyPixels(VGint dx, VGint dy,
+ VGint sx, VGint sy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb;
+ struct st_renderbuffer *strb = ctx->draw_buffer->strb;
+
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ /* do nothing if we copy from outside the fb */
+ if (dx >= (VGint)fb->width || dy >= (VGint)fb->height ||
+ sx >= (VGint)fb->width || sy >= (VGint)fb->height)
+ return;
+
+ vg_validate_state(ctx);
+ /* make sure rendering has completed */
+ vgFinish();
+
+ vg_copy_surface(ctx, strb->surface, dx, dy,
+ strb->surface, sx, sy, width, height);
+}
diff --git a/src/gallium/state_trackers/vega/api_masks.c b/src/gallium/state_trackers/vega/api_masks.c
new file mode 100644
index 00000000000..4f9f3dae173
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_masks.c
@@ -0,0 +1,373 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "VG/openvg.h"
+
+#include "mask.h"
+#include "renderer.h"
+
+#include "vg_context.h"
+#include "pipe/p_context.h"
+#include "pipe/p_inlines.h"
+#include "pipe/internal/p_winsys_screen.h" /* for winsys->update_buffer */
+
+#include "util/u_pack_color.h"
+#include "util/u_draw_quad.h"
+#include "util/u_memory.h"
+
+
+#define DISABLE_1_1_MASKING 1
+
+/**
+ * Draw a screen-aligned quadrilateral.
+ * Coords are window coords with y=0=bottom. These coords will be transformed
+ * by the vertex shader and viewport transform.
+ */
+static void
+draw_clear_quad(struct vg_context *st,
+ float x0, float y0, float x1, float y1, float z,
+ const VGfloat color[4])
+{
+ struct pipe_context *pipe = st->pipe;
+ struct pipe_buffer *buf;
+ VGuint i;
+
+ /* positions */
+ st->clear.vertices[0][0][0] = x0;
+ st->clear.vertices[0][0][1] = y0;
+
+ st->clear.vertices[1][0][0] = x1;
+ st->clear.vertices[1][0][1] = y0;
+
+ st->clear.vertices[2][0][0] = x1;
+ st->clear.vertices[2][0][1] = y1;
+
+ st->clear.vertices[3][0][0] = x0;
+ st->clear.vertices[3][0][1] = y1;
+
+ /* same for all verts: */
+ for (i = 0; i < 4; i++) {
+ st->clear.vertices[i][0][2] = z;
+ st->clear.vertices[i][0][3] = 1.0;
+ st->clear.vertices[i][1][0] = color[0];
+ st->clear.vertices[i][1][1] = color[1];
+ st->clear.vertices[i][1][2] = color[2];
+ st->clear.vertices[i][1][3] = color[3];
+ }
+
+
+ /* put vertex data into vbuf */
+ buf = pipe_user_buffer_create(pipe->screen,
+ st->clear.vertices,
+ sizeof(st->clear.vertices));
+
+
+ /* draw */
+ if (buf) {
+ util_draw_vertex_buffer(pipe, buf, 0,
+ PIPE_PRIM_TRIANGLE_FAN,
+ 4, /* verts */
+ 2); /* attribs/vert */
+
+ pipe_buffer_reference(&buf, NULL);
+ }
+}
+
+/**
+ * Do vgClear by drawing a quadrilateral.
+ */
+static void
+clear_with_quad(struct vg_context *st, float x0, float y0,
+ float width, float height, const VGfloat clear_color[4])
+{
+ VGfloat x1, y1;
+
+ vg_validate_state(st);
+
+ x1 = x0 + width;
+ y1 = y0 + height;
+
+ /*
+ printf("%s %f,%f %f,%f\n", __FUNCTION__,
+ x0, y0,
+ x1, y1);
+ */
+
+ if (st->pipe->winsys && st->pipe->winsys->update_buffer)
+ st->pipe->winsys->update_buffer( st->pipe->winsys,
+ st->pipe->priv );
+
+ cso_save_blend(st->cso_context);
+ cso_save_rasterizer(st->cso_context);
+ cso_save_fragment_shader(st->cso_context);
+ cso_save_vertex_shader(st->cso_context);
+
+ /* blend state: RGBA masking */
+ {
+ struct pipe_blend_state blend;
+ memset(&blend, 0, sizeof(blend));
+ blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE;
+ blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE;
+ blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO;
+ blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO;
+ blend.colormask |= PIPE_MASK_R;
+ blend.colormask |= PIPE_MASK_G;
+ blend.colormask |= PIPE_MASK_B;
+ blend.colormask |= PIPE_MASK_A;
+ cso_set_blend(st->cso_context, &blend);
+ }
+
+ cso_set_rasterizer(st->cso_context, &st->clear.raster);
+
+ cso_set_fragment_shader_handle(st->cso_context, st->clear.fs);
+ cso_set_vertex_shader_handle(st->cso_context, vg_clear_vs(st));
+
+ /* draw quad matching scissor rect (XXX verify coord round-off) */
+ draw_clear_quad(st, x0, y0, x1, y1, 0, clear_color);
+
+ /* Restore pipe state */
+ cso_restore_blend(st->cso_context);
+ cso_restore_rasterizer(st->cso_context);
+ cso_restore_fragment_shader(st->cso_context);
+ cso_restore_vertex_shader(st->cso_context);
+}
+
+
+void vgMask(VGHandle mask, VGMaskOperation operation,
+ VGint x, VGint y,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (width <=0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (operation < VG_CLEAR_MASK || operation > VG_SUBTRACT_MASK) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+
+ vg_validate_state(ctx);
+
+ if (operation == VG_CLEAR_MASK) {
+ mask_fill(x, y, width, height, 0.f);
+ } else if (operation == VG_FILL_MASK) {
+ mask_fill(x, y, width, height, 1.f);
+ } else if (vg_object_is_valid((void*)mask, VG_OBJECT_IMAGE)) {
+ struct vg_image *image = (struct vg_image *)mask;
+ mask_using_image(image, operation, x, y, width, height);
+ } else if (vg_object_is_valid((void*)mask, VG_OBJECT_MASK)) {
+#if DISABLE_1_1_MASKING
+ return;
+#else
+ struct vg_mask_layer *layer = (struct vg_mask_layer *)mask;
+ mask_using_layer(layer, operation, x, y, width, height);
+#endif
+ } else {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ }
+}
+
+void vgClear(VGint x, VGint y,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_framebuffer_state *fb;
+
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ vg_validate_state(ctx);
+#if 0
+ debug_printf("Clear [%d, %d, %d, %d] with [%f, %f, %f, %f]\n",
+ x, y, width, height,
+ ctx->state.vg.clear_color[0],
+ ctx->state.vg.clear_color[1],
+ ctx->state.vg.clear_color[2],
+ ctx->state.vg.clear_color[3]);
+#endif
+
+ fb = &ctx->state.g3d.fb;
+ /* check for a whole surface clear */
+ if (!ctx->state.vg.scissoring &&
+ (x == 0 && y == 0 && width == fb->width && height == fb->height)) {
+ ctx->pipe->clear(ctx->pipe, PIPE_CLEAR_COLOR | PIPE_CLEAR_DEPTHSTENCIL,
+ ctx->state.vg.clear_color, 1., 0);
+ } else {
+ clear_with_quad(ctx, x, y, width, height, ctx->state.vg.clear_color);
+ }
+}
+
+
+#ifdef OPENVG_VERSION_1_1
+
+
+void vgRenderToMask(VGPath path,
+ VGbitfield paintModes,
+ VGMaskOperation operation)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (path == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (!paintModes || (paintModes&(~(VG_STROKE_PATH|VG_FILL_PATH)))) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (operation < VG_CLEAR_MASK ||
+ operation > VG_SUBTRACT_MASK) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (!vg_object_is_valid((void*)path, VG_OBJECT_PATH)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+#if DISABLE_1_1_MASKING
+ return;
+#endif
+
+ vg_validate_state(ctx);
+
+ mask_render_to((struct path *)path, paintModes, operation);
+}
+
+VGMaskLayer vgCreateMaskLayer(VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (width <= 0 || height <= 0 ||
+ width > vgGeti(VG_MAX_IMAGE_WIDTH) ||
+ height > vgGeti(VG_MAX_IMAGE_HEIGHT)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+
+ return (VGMaskLayer)mask_layer_create(width, height);
+}
+
+void vgDestroyMaskLayer(VGMaskLayer maskLayer)
+{
+ struct vg_mask_layer *mask = 0;
+ struct vg_context *ctx = vg_current_context();
+
+ if (maskLayer == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (!vg_object_is_valid((void*)maskLayer, VG_OBJECT_MASK)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ mask = (struct vg_mask_layer *)maskLayer;
+ mask_layer_destroy(mask);
+}
+
+void vgFillMaskLayer(VGMaskLayer maskLayer,
+ VGint x, VGint y,
+ VGint width, VGint height,
+ VGfloat value)
+{
+ struct vg_mask_layer *mask = 0;
+ struct vg_context *ctx = vg_current_context();
+
+ if (maskLayer == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (value < 0 || value > 1) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (x < 0 || y < 0 || (x + width) < 0 || (y + height) < 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (!vg_object_is_valid((void*)maskLayer, VG_OBJECT_MASK)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ mask = (struct vg_mask_layer*)maskLayer;
+
+ if (x + width > mask_layer_width(mask) ||
+ y + height > mask_layer_height(mask)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+#if DISABLE_1_1_MASKING
+ return;
+#endif
+ mask_layer_fill(mask, x, y, width, height, value);
+}
+
+void vgCopyMask(VGMaskLayer maskLayer,
+ VGint sx, VGint sy,
+ VGint dx, VGint dy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_mask_layer *mask = 0;
+
+ if (maskLayer == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (!vg_object_is_valid((void*)maskLayer, VG_OBJECT_MASK)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+#if DISABLE_1_1_MASKING
+ return;
+#endif
+
+ mask = (struct vg_mask_layer*)maskLayer;
+ mask_copy(mask, sx, sy, dx, dy, width, height);
+}
+
+#endif
diff --git a/src/gallium/state_trackers/vega/api_misc.c b/src/gallium/state_trackers/vega/api_misc.c
new file mode 100644
index 00000000000..78ba0bc1103
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_misc.c
@@ -0,0 +1,83 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "VG/openvg.h"
+
+#include "vg_context.h"
+
+/* Hardware Queries */
+VGHardwareQueryResult vgHardwareQuery(VGHardwareQueryType key,
+ VGint setting)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (key < VG_IMAGE_FORMAT_QUERY ||
+ key > VG_PATH_DATATYPE_QUERY) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_HARDWARE_UNACCELERATED;
+ }
+
+ if (key == VG_IMAGE_FORMAT_QUERY) {
+ if (setting < VG_sRGBX_8888 ||
+ setting > VG_lABGR_8888_PRE) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_HARDWARE_UNACCELERATED;
+ }
+ } else if (key == VG_PATH_DATATYPE_QUERY) {
+ if (setting < VG_PATH_DATATYPE_S_8 ||
+ setting > VG_PATH_DATATYPE_F) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_HARDWARE_UNACCELERATED;
+ }
+ }
+ /* we're supposed to accelerate everything */
+ return VG_HARDWARE_ACCELERATED;
+}
+
+/* Renderer and Extension Information */
+const VGubyte *vgGetString(VGStringID name)
+{
+ struct vg_context *ctx = vg_current_context();
+ static const VGubyte *vendor = (VGubyte *)"Tungsten Graphics, Inc";
+ static const VGubyte *renderer = (VGubyte *)"Vega OpenVG 1.0";
+ static const VGubyte *version = (VGubyte *)"1.0";
+
+ if (!ctx)
+ return NULL;
+
+ switch(name) {
+ case VG_VENDOR:
+ return vendor;
+ case VG_RENDERER:
+ return renderer;
+ case VG_VERSION:
+ return version;
+ case VG_EXTENSIONS:
+ return NULL;
+ default:
+ return NULL;
+ }
+}
diff --git a/src/gallium/state_trackers/vega/api_paint.c b/src/gallium/state_trackers/vega/api_paint.c
new file mode 100644
index 00000000000..dd3ac5bdb09
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_paint.c
@@ -0,0 +1,166 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "VG/openvg.h"
+
+#include "vg_context.h"
+#include "paint.h"
+#include "image.h"
+
+VGPaint vgCreatePaint(void)
+{
+ return (VGPaint) paint_create(vg_current_context());
+}
+
+void vgDestroyPaint(VGPaint p)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_paint *paint;
+
+ if (p == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ paint = (struct vg_paint *)p;
+ paint_destroy(paint);
+}
+
+void vgSetPaint(VGPaint paint, VGbitfield paintModes)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (paint == VG_INVALID_HANDLE) {
+ /* restore the default */
+ paint = (VGPaint)ctx->default_paint;
+ } else if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (!(paintModes & ((VG_FILL_PATH|VG_STROKE_PATH)))) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (paintModes & VG_FILL_PATH) {
+ ctx->state.vg.fill_paint = (struct vg_paint *)paint;
+ }
+ if (paintModes & VG_STROKE_PATH) {
+ ctx->state.vg.stroke_paint = (struct vg_paint *)paint;
+ }
+}
+
+VGPaint vgGetPaint(VGPaintMode paintMode)
+{
+ struct vg_context *ctx = vg_current_context();
+ VGPaint paint = VG_INVALID_HANDLE;
+
+ if (paintMode < VG_STROKE_PATH || paintMode > VG_FILL_PATH) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+
+ if (paintMode == VG_FILL_PATH)
+ paint = (VGPaint)ctx->state.vg.fill_paint;
+ else if (paintMode == VG_STROKE_PATH)
+ paint = (VGPaint)ctx->state.vg.stroke_paint;
+
+ if (paint == (VGPaint)ctx->default_paint)
+ paint = VG_INVALID_HANDLE;
+
+ return paint;
+}
+
+void vgSetColor(VGPaint paint, VGuint rgba)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (paint == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ {
+ struct vg_paint *p = (struct vg_paint *)paint;
+ paint_set_colori(p, rgba);
+ }
+}
+
+VGuint vgGetColor(VGPaint paint)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_paint *p;
+ VGuint rgba = 0;
+
+ if (paint == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return rgba;
+ }
+
+ if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return rgba;
+ }
+ p = (struct vg_paint *)paint;
+
+ return paint_colori(p);
+}
+
+void vgPaintPattern(VGPaint paint, VGImage pattern)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (paint == VG_INVALID_HANDLE ||
+ !vg_context_is_object_valid(ctx, VG_OBJECT_PAINT, (void *)paint)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (pattern == VG_INVALID_HANDLE) {
+ paint_set_type((struct vg_paint*)paint, VG_PAINT_TYPE_COLOR);
+ return;
+ }
+
+ if (!vg_context_is_object_valid(ctx, VG_OBJECT_IMAGE, (void *)pattern)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+
+ if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT) ||
+ !vg_object_is_valid((void*)pattern, VG_OBJECT_IMAGE)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ paint_set_pattern((struct vg_paint*)paint,
+ (struct vg_image*)pattern);
+}
+
diff --git a/src/gallium/state_trackers/vega/api_params.c b/src/gallium/state_trackers/vega/api_params.c
new file mode 100644
index 00000000000..db77fd9cb05
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_params.c
@@ -0,0 +1,1673 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "VG/openvg.h"
+
+#include "vg_context.h"
+#include "paint.h"
+#include "path.h"
+#include "image.h"
+#include "matrix.h"
+#include "api_consts.h"
+
+#include "pipe/p_compiler.h"
+#include "util/u_pointer.h"
+#include "util/u_math.h"
+
+#include <math.h>
+
+static INLINE struct vg_state *current_state()
+{
+ struct vg_context *ctx = vg_current_context();
+ if (!ctx)
+ return 0;
+ else
+ return &ctx->state.vg;
+}
+
+static INLINE VGboolean count_in_bounds(VGParamType type, VGint count)
+{
+ if (count < 0)
+ return VG_FALSE;
+
+ if (type == VG_SCISSOR_RECTS)
+ return (!(count % 4) && (count >= 0 || count <= VEGA_MAX_SCISSOR_RECTS * 4));
+ else if (type == VG_STROKE_DASH_PATTERN) {
+ return count <= VEGA_MAX_DASH_COUNT;
+ } else {
+ VGint real_count = vgGetVectorSize(type);
+ return count == real_count;
+ }
+}
+
+void vgSetf (VGParamType type, VGfloat value)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_state *state = current_state();
+ VGErrorCode error = VG_NO_ERROR;
+
+ switch(type) {
+ case VG_MATRIX_MODE:
+ case VG_FILL_RULE:
+ case VG_IMAGE_QUALITY:
+ case VG_RENDERING_QUALITY:
+ case VG_BLEND_MODE:
+ case VG_IMAGE_MODE:
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM:
+#endif
+ case VG_STROKE_CAP_STYLE:
+ case VG_STROKE_JOIN_STYLE:
+ case VG_STROKE_DASH_PHASE_RESET:
+ case VG_MASKING:
+ case VG_SCISSORING:
+ case VG_PIXEL_LAYOUT:
+ case VG_SCREEN_LAYOUT:
+ case VG_FILTER_FORMAT_LINEAR:
+ case VG_FILTER_FORMAT_PREMULTIPLIED:
+ case VG_FILTER_CHANNEL_MASK:
+
+ case VG_MAX_SCISSOR_RECTS:
+ case VG_MAX_DASH_COUNT:
+ case VG_MAX_KERNEL_SIZE:
+ case VG_MAX_SEPARABLE_KERNEL_SIZE:
+ case VG_MAX_COLOR_RAMP_STOPS:
+ case VG_MAX_IMAGE_WIDTH:
+ case VG_MAX_IMAGE_HEIGHT:
+ case VG_MAX_IMAGE_PIXELS:
+ case VG_MAX_IMAGE_BYTES:
+ case VG_MAX_GAUSSIAN_STD_DEVIATION:
+ case VG_MAX_FLOAT:
+ vgSeti(type, floor(value));
+ return;
+ break;
+ case VG_STROKE_LINE_WIDTH:
+ state->stroke.line_width.f = value;
+ state->stroke.line_width.i = float_to_int_floor(*((VGuint*)(&value)));
+ break;
+ case VG_STROKE_MITER_LIMIT:
+ state->stroke.miter_limit.f = value;
+ state->stroke.miter_limit.i = float_to_int_floor(*((VGuint*)(&value)));
+ break;
+ case VG_STROKE_DASH_PHASE:
+ state->stroke.dash_phase.f = value;
+ state->stroke.dash_phase.i = float_to_int_floor(*((VGuint*)(&value)));
+ break;
+ default:
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ break;
+ }
+ vg_set_error(ctx, error);
+}
+
+void vgSeti (VGParamType type, VGint value)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_state *state = current_state();
+ VGErrorCode error = VG_NO_ERROR;
+
+ switch(type) {
+ case VG_MATRIX_MODE:
+ if (value < VG_MATRIX_PATH_USER_TO_SURFACE ||
+#ifdef OPENVG_VERSION_1_1
+ value > VG_MATRIX_GLYPH_USER_TO_SURFACE)
+#else
+ value > VG_MATRIX_STROKE_PAINT_TO_USER)
+#endif
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ else
+ state->matrix_mode = value;
+ break;
+ case VG_FILL_RULE:
+ if (value < VG_EVEN_ODD ||
+ value > VG_NON_ZERO)
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ else
+ state->fill_rule = value;
+ break;
+ case VG_IMAGE_QUALITY:
+ state->image_quality = value;
+ break;
+ case VG_RENDERING_QUALITY:
+ if (value < VG_RENDERING_QUALITY_NONANTIALIASED ||
+ value > VG_RENDERING_QUALITY_BETTER)
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ else
+ state->rendering_quality = value;
+ break;
+ case VG_BLEND_MODE:
+ if (value < VG_BLEND_SRC ||
+ value > VG_BLEND_ADDITIVE)
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ else {
+ ctx->state.dirty |= BLEND_DIRTY;
+ state->blend_mode = value;
+ }
+ break;
+ case VG_IMAGE_MODE:
+ if (value < VG_DRAW_IMAGE_NORMAL ||
+ value > VG_DRAW_IMAGE_STENCIL)
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ else
+ state->image_mode = value;
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM:
+ state->color_transform = value;
+#endif
+ break;
+ case VG_STROKE_LINE_WIDTH:
+ state->stroke.line_width.f = value;
+ state->stroke.line_width.i = value;
+ break;
+ case VG_STROKE_CAP_STYLE:
+ if (value < VG_CAP_BUTT ||
+ value > VG_CAP_SQUARE)
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ else
+ state->stroke.cap_style = value;
+ break;
+ case VG_STROKE_JOIN_STYLE:
+ if (value < VG_JOIN_MITER ||
+ value > VG_JOIN_BEVEL)
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ else
+ state->stroke.join_style = value;
+ break;
+ case VG_STROKE_MITER_LIMIT:
+ state->stroke.miter_limit.f = value;
+ state->stroke.miter_limit.i = value;
+ break;
+ case VG_STROKE_DASH_PHASE:
+ state->stroke.dash_phase.f = value;
+ state->stroke.dash_phase.i = value;
+ break;
+ case VG_STROKE_DASH_PHASE_RESET:
+ state->stroke.dash_phase_reset = value;
+ break;
+ case VG_MASKING:
+ state->masking = value;
+ break;
+ case VG_SCISSORING:
+ state->scissoring = value;
+ ctx->state.dirty |= DEPTH_STENCIL_DIRTY;
+ break;
+ case VG_PIXEL_LAYOUT:
+ if (value < VG_PIXEL_LAYOUT_UNKNOWN ||
+ value > VG_PIXEL_LAYOUT_BGR_HORIZONTAL)
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ else
+ state->pixel_layout = value;
+ break;
+ case VG_SCREEN_LAYOUT:
+ /* read only ignore */
+ break;
+ case VG_FILTER_FORMAT_LINEAR:
+ state->filter_format_linear = value;
+ break;
+ case VG_FILTER_FORMAT_PREMULTIPLIED:
+ state->filter_format_premultiplied = value;
+ break;
+ case VG_FILTER_CHANNEL_MASK:
+ state->filter_channel_mask = value;
+ break;
+
+ case VG_MAX_SCISSOR_RECTS:
+ case VG_MAX_DASH_COUNT:
+ case VG_MAX_KERNEL_SIZE:
+ case VG_MAX_SEPARABLE_KERNEL_SIZE:
+ case VG_MAX_COLOR_RAMP_STOPS:
+ case VG_MAX_IMAGE_WIDTH:
+ case VG_MAX_IMAGE_HEIGHT:
+ case VG_MAX_IMAGE_PIXELS:
+ case VG_MAX_IMAGE_BYTES:
+ case VG_MAX_GAUSSIAN_STD_DEVIATION:
+ case VG_MAX_FLOAT:
+ /* read only ignore */
+ break;
+ default:
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ break;
+ }
+ vg_set_error(ctx, error);
+}
+
+void vgSetfv(VGParamType type, VGint count,
+ const VGfloat * values)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_state *state = current_state();
+ VGErrorCode error = VG_NO_ERROR;
+
+ if ((count && !values) || !count_in_bounds(type, count) || !is_aligned(values)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ switch(type) {
+ case VG_MATRIX_MODE:
+ case VG_FILL_RULE:
+ case VG_IMAGE_QUALITY:
+ case VG_RENDERING_QUALITY:
+ case VG_BLEND_MODE:
+ case VG_IMAGE_MODE:
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM:
+#endif
+ case VG_STROKE_CAP_STYLE:
+ case VG_STROKE_JOIN_STYLE:
+ case VG_STROKE_DASH_PHASE_RESET:
+ case VG_MASKING:
+ case VG_SCISSORING:
+ case VG_PIXEL_LAYOUT:
+ case VG_SCREEN_LAYOUT:
+ case VG_FILTER_FORMAT_LINEAR:
+ case VG_FILTER_FORMAT_PREMULTIPLIED:
+ case VG_FILTER_CHANNEL_MASK:
+ vgSeti(type, floor(values[0]));
+ return;
+ break;
+ case VG_SCISSOR_RECTS: {
+ VGint i;
+ VGuint *x = (VGuint*)values;
+ for (i = 0; i < count; ++i) {
+ state->scissor_rects[i].f = values[i];
+ state->scissor_rects[i].i = float_to_int_floor(x[i]);
+ }
+ state->scissor_rects_num = count / 4;
+ ctx->state.dirty |= DEPTH_STENCIL_DIRTY;
+ }
+ break;
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM_VALUES: {
+ VGint i;
+ for (i = 0; i < count; ++i) {
+ state->color_transform_values[i] = values[i];
+ }
+ }
+ break;
+#endif
+ case VG_STROKE_LINE_WIDTH:
+ state->stroke.line_width.f = values[0];
+ state->stroke.line_width.i = float_to_int_floor(*((VGuint*)(values)));
+ break;
+ case VG_STROKE_MITER_LIMIT:
+ state->stroke.miter_limit.f = values[0];
+ state->stroke.miter_limit.i = float_to_int_floor(*((VGuint*)(values)));
+ break;
+ case VG_STROKE_DASH_PATTERN: {
+ int i;
+ for (i = 0; i < count; ++i) {
+ state->stroke.dash_pattern[i].f = values[i];
+ state->stroke.dash_pattern[i].i =
+ float_to_int_floor(*((VGuint*)(values + i)));
+ }
+ state->stroke.dash_pattern_num = count;
+ }
+ break;
+ case VG_STROKE_DASH_PHASE:
+ state->stroke.dash_phase.f = values[0];
+ state->stroke.dash_phase.i = float_to_int_floor(*((VGuint*)(values)));
+ break;
+ case VG_TILE_FILL_COLOR:
+ state->tile_fill_color[0] = values[0];
+ state->tile_fill_color[1] = values[1];
+ state->tile_fill_color[2] = values[2];
+ state->tile_fill_color[3] = values[3];
+
+ state->tile_fill_colori[0] = float_to_int_floor(*((VGuint*)(values + 0)));
+ state->tile_fill_colori[1] = float_to_int_floor(*((VGuint*)(values + 1)));
+ state->tile_fill_colori[2] = float_to_int_floor(*((VGuint*)(values + 2)));
+ state->tile_fill_colori[3] = float_to_int_floor(*((VGuint*)(values + 3)));
+ break;
+ case VG_CLEAR_COLOR:
+ state->clear_color[0] = values[0];
+ state->clear_color[1] = values[1];
+ state->clear_color[2] = values[2];
+ state->clear_color[3] = values[3];
+
+ state->clear_colori[0] = float_to_int_floor(*((VGuint*)(values + 0)));
+ state->clear_colori[1] = float_to_int_floor(*((VGuint*)(values + 1)));
+ state->clear_colori[2] = float_to_int_floor(*((VGuint*)(values + 2)));
+ state->clear_colori[3] = float_to_int_floor(*((VGuint*)(values + 3)));
+ break;
+#ifdef OPENVG_VERSION_1_1
+ case VG_GLYPH_ORIGIN:
+ state->glyph_origin[0].f = values[0];
+ state->glyph_origin[1].f = values[1];
+
+ state->glyph_origin[0].i = float_to_int_floor(*((VGuint*)(values + 0)));
+ state->glyph_origin[1].i = float_to_int_floor(*((VGuint*)(values + 1)));
+ break;
+#endif
+
+ case VG_MAX_SCISSOR_RECTS:
+ case VG_MAX_DASH_COUNT:
+ case VG_MAX_KERNEL_SIZE:
+ case VG_MAX_SEPARABLE_KERNEL_SIZE:
+ case VG_MAX_COLOR_RAMP_STOPS:
+ case VG_MAX_IMAGE_WIDTH:
+ case VG_MAX_IMAGE_HEIGHT:
+ case VG_MAX_IMAGE_PIXELS:
+ case VG_MAX_IMAGE_BYTES:
+ case VG_MAX_GAUSSIAN_STD_DEVIATION:
+ case VG_MAX_FLOAT:
+ break;
+ default:
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ break;
+ }
+ vg_set_error(ctx, error);
+}
+
+void vgSetiv(VGParamType type, VGint count,
+ const VGint * values)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_state *state = current_state();
+
+ if ((count && !values) || !count_in_bounds(type, count) || !is_aligned(values)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ switch(type) {
+ case VG_MATRIX_MODE:
+ case VG_FILL_RULE:
+ case VG_IMAGE_QUALITY:
+ case VG_RENDERING_QUALITY:
+ case VG_BLEND_MODE:
+ case VG_IMAGE_MODE:
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM:
+#endif
+ case VG_STROKE_CAP_STYLE:
+ case VG_STROKE_JOIN_STYLE:
+ case VG_STROKE_DASH_PHASE_RESET:
+ case VG_MASKING:
+ case VG_SCISSORING:
+ case VG_PIXEL_LAYOUT:
+ case VG_SCREEN_LAYOUT:
+ case VG_FILTER_FORMAT_LINEAR:
+ case VG_FILTER_FORMAT_PREMULTIPLIED:
+ case VG_FILTER_CHANNEL_MASK:
+ vgSeti(type, values[0]);
+ return;
+ break;
+ case VG_SCISSOR_RECTS: {
+ VGint i;
+ for (i = 0; i < count; ++i) {
+ state->scissor_rects[i].i = values[i];
+ state->scissor_rects[i].f = values[i];
+ }
+ state->scissor_rects_num = count / 4;
+ ctx->state.dirty |= DEPTH_STENCIL_DIRTY;
+ }
+ break;
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM_VALUES: {
+ VGint i;
+ for (i = 0; i < count; ++i) {
+ state->color_transform_values[i] = values[i];
+ }
+ }
+ break;
+#endif
+ case VG_STROKE_LINE_WIDTH:
+ state->stroke.line_width.f = values[0];
+ state->stroke.line_width.i = values[0];
+ break;
+ case VG_STROKE_MITER_LIMIT:
+ state->stroke.miter_limit.f = values[0];
+ state->stroke.miter_limit.i = values[0];
+ break;
+ case VG_STROKE_DASH_PATTERN: {
+ int i;
+ for (i = 0; i < count; ++i) {
+ state->stroke.dash_pattern[i].f = values[i];
+ state->stroke.dash_pattern[i].i = values[i];
+ }
+ state->stroke.dash_pattern_num = count;
+ }
+ break;
+ case VG_STROKE_DASH_PHASE:
+ state->stroke.dash_phase.f = values[0];
+ state->stroke.dash_phase.i = values[0];
+ break;
+ case VG_TILE_FILL_COLOR:
+ state->tile_fill_color[0] = values[0];
+ state->tile_fill_color[1] = values[1];
+ state->tile_fill_color[2] = values[2];
+ state->tile_fill_color[3] = values[3];
+
+ state->tile_fill_colori[0] = values[0];
+ state->tile_fill_colori[1] = values[1];
+ state->tile_fill_colori[2] = values[2];
+ state->tile_fill_colori[3] = values[3];
+ break;
+ case VG_CLEAR_COLOR:
+ state->clear_color[0] = values[0];
+ state->clear_color[1] = values[1];
+ state->clear_color[2] = values[2];
+ state->clear_color[3] = values[3];
+
+ state->clear_colori[0] = values[0];
+ state->clear_colori[1] = values[1];
+ state->clear_colori[2] = values[2];
+ state->clear_colori[3] = values[3];
+ break;
+#ifdef OPENVG_VERSION_1_1
+ case VG_GLYPH_ORIGIN:
+ state->glyph_origin[0].f = values[0];
+ state->glyph_origin[1].f = values[1];
+ state->glyph_origin[0].i = values[0];
+ state->glyph_origin[1].i = values[1];
+ break;
+#endif
+
+ case VG_MAX_SCISSOR_RECTS:
+ case VG_MAX_DASH_COUNT:
+ case VG_MAX_KERNEL_SIZE:
+ case VG_MAX_SEPARABLE_KERNEL_SIZE:
+ case VG_MAX_COLOR_RAMP_STOPS:
+ case VG_MAX_IMAGE_WIDTH:
+ case VG_MAX_IMAGE_HEIGHT:
+ case VG_MAX_IMAGE_PIXELS:
+ case VG_MAX_IMAGE_BYTES:
+ case VG_MAX_GAUSSIAN_STD_DEVIATION:
+ case VG_MAX_FLOAT:
+ break;
+
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ }
+}
+
+VGfloat vgGetf(VGParamType type)
+{
+ struct vg_context *ctx = vg_current_context();
+ const struct vg_state *state = current_state();
+ VGErrorCode error = VG_NO_ERROR;
+ VGfloat value = 0.0f;
+
+ switch(type) {
+ case VG_MATRIX_MODE:
+ case VG_FILL_RULE:
+ case VG_IMAGE_QUALITY:
+ case VG_RENDERING_QUALITY:
+ case VG_BLEND_MODE:
+ case VG_IMAGE_MODE:
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM:
+#endif
+ case VG_STROKE_CAP_STYLE:
+ case VG_STROKE_JOIN_STYLE:
+ case VG_STROKE_DASH_PHASE_RESET:
+ case VG_MASKING:
+ case VG_SCISSORING:
+ case VG_PIXEL_LAYOUT:
+ case VG_SCREEN_LAYOUT:
+ case VG_FILTER_FORMAT_LINEAR:
+ case VG_FILTER_FORMAT_PREMULTIPLIED:
+ case VG_FILTER_CHANNEL_MASK:
+ return vgGeti(type);
+ break;
+ case VG_STROKE_LINE_WIDTH:
+ value = state->stroke.line_width.f;
+ break;
+ case VG_STROKE_MITER_LIMIT:
+ value = state->stroke.miter_limit.f;
+ break;
+ case VG_STROKE_DASH_PHASE:
+ value = state->stroke.dash_phase.f;
+ break;
+
+ case VG_MAX_SCISSOR_RECTS:
+ case VG_MAX_DASH_COUNT:
+ case VG_MAX_KERNEL_SIZE:
+ case VG_MAX_SEPARABLE_KERNEL_SIZE:
+ case VG_MAX_COLOR_RAMP_STOPS:
+ case VG_MAX_IMAGE_WIDTH:
+ case VG_MAX_IMAGE_HEIGHT:
+ case VG_MAX_IMAGE_PIXELS:
+ case VG_MAX_IMAGE_BYTES:
+ case VG_MAX_GAUSSIAN_STD_DEVIATION:
+ return vgGeti(type);
+ break;
+ case VG_MAX_FLOAT:
+ value = 1e+10;/*must be at least 1e+10*/
+ break;
+ default:
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ break;
+ }
+ vg_set_error(ctx, error);
+ return value;
+}
+
+VGint vgGeti(VGParamType type)
+{
+ const struct vg_state *state = current_state();
+ struct vg_context *ctx = vg_current_context();
+ VGErrorCode error = VG_NO_ERROR;
+ VGint value = 0;
+
+ switch(type) {
+ case VG_MATRIX_MODE:
+ value = state->matrix_mode;
+ break;
+ case VG_FILL_RULE:
+ value = state->fill_rule;
+ break;
+ case VG_IMAGE_QUALITY:
+ value = state->image_quality;
+ break;
+ case VG_RENDERING_QUALITY:
+ value = state->rendering_quality;
+ break;
+ case VG_BLEND_MODE:
+ value = state->blend_mode;
+ break;
+ case VG_IMAGE_MODE:
+ value = state->image_mode;
+ break;
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM:
+ value = state->color_transform;
+ break;
+#endif
+ case VG_STROKE_LINE_WIDTH:
+ value = state->stroke.line_width.i;
+ break;
+ case VG_STROKE_CAP_STYLE:
+ value = state->stroke.cap_style;
+ break;
+ case VG_STROKE_JOIN_STYLE:
+ value = state->stroke.join_style;
+ break;
+ case VG_STROKE_MITER_LIMIT:
+ value = state->stroke.miter_limit.i;
+ break;
+ case VG_STROKE_DASH_PHASE:
+ value = state->stroke.dash_phase.i;
+ break;
+ case VG_STROKE_DASH_PHASE_RESET:
+ value = state->stroke.dash_phase_reset;
+ break;
+ case VG_MASKING:
+ value = state->masking;
+ break;
+ case VG_SCISSORING:
+ value = state->scissoring;
+ break;
+ case VG_PIXEL_LAYOUT:
+ value = state->pixel_layout;
+ break;
+ case VG_SCREEN_LAYOUT:
+ value = state->screen_layout;
+ break;
+ case VG_FILTER_FORMAT_LINEAR:
+ value = state->filter_format_linear;
+ break;
+ case VG_FILTER_FORMAT_PREMULTIPLIED:
+ value = state->filter_format_premultiplied;
+ break;
+ case VG_FILTER_CHANNEL_MASK:
+ value = state->filter_channel_mask;
+ break;
+
+ case VG_MAX_SCISSOR_RECTS:
+ value = 32; /*must be at least 32*/
+ break;
+ case VG_MAX_DASH_COUNT:
+ value = 16; /*must be at least 16*/
+ break;
+ case VG_MAX_KERNEL_SIZE:
+ value = 7; /*must be at least 7*/
+ break;
+ case VG_MAX_SEPARABLE_KERNEL_SIZE:
+ value = 15; /*must be at least 15*/
+ break;
+ case VG_MAX_COLOR_RAMP_STOPS:
+ value = 256; /*must be at least 32*/
+ break;
+ case VG_MAX_IMAGE_WIDTH:
+ value = 2048;
+ break;
+ case VG_MAX_IMAGE_HEIGHT:
+ value = 2048;
+ break;
+ case VG_MAX_IMAGE_PIXELS:
+ value = 2048*2048;
+ break;
+ case VG_MAX_IMAGE_BYTES:
+ value = 2048*2048 * 4;
+ break;
+ case VG_MAX_GAUSSIAN_STD_DEVIATION:
+ value = 128; /*must be at least 128*/
+ break;
+
+ case VG_MAX_FLOAT: {
+ VGfloat val = vgGetf(type);
+ value = float_to_int_floor(*((VGuint*)&val));
+ }
+ break;
+ default:
+ error = VG_ILLEGAL_ARGUMENT_ERROR;
+ break;
+ }
+ vg_set_error(ctx, error);
+ return value;
+}
+
+VGint vgGetVectorSize(VGParamType type)
+{
+ struct vg_context *ctx = vg_current_context();
+ const struct vg_state *state = current_state();
+ switch(type) {
+ case VG_MATRIX_MODE:
+ case VG_FILL_RULE:
+ case VG_IMAGE_QUALITY:
+ case VG_RENDERING_QUALITY:
+ case VG_BLEND_MODE:
+ case VG_IMAGE_MODE:
+ return 1;
+ case VG_SCISSOR_RECTS:
+ return state->scissor_rects_num * 4;
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM:
+ return 1;
+ case VG_COLOR_TRANSFORM_VALUES:
+ return 8;
+#endif
+ case VG_STROKE_LINE_WIDTH:
+ case VG_STROKE_CAP_STYLE:
+ case VG_STROKE_JOIN_STYLE:
+ case VG_STROKE_MITER_LIMIT:
+ return 1;
+ case VG_STROKE_DASH_PATTERN:
+ return state->stroke.dash_pattern_num;
+ case VG_STROKE_DASH_PHASE:
+ return 1;
+ case VG_STROKE_DASH_PHASE_RESET:
+ return 1;
+ case VG_TILE_FILL_COLOR:
+ return 4;
+ case VG_CLEAR_COLOR:
+ return 4;
+#ifdef OPENVG_VERSION_1_1
+ case VG_GLYPH_ORIGIN:
+ return 2;
+#endif
+ case VG_MASKING:
+ return 1;
+ case VG_SCISSORING:
+ return 1;
+ case VG_PIXEL_LAYOUT:
+ return 1;
+ case VG_SCREEN_LAYOUT:
+ return 1;
+ case VG_FILTER_FORMAT_LINEAR:
+ return 1;
+ case VG_FILTER_FORMAT_PREMULTIPLIED:
+ return 1;
+ case VG_FILTER_CHANNEL_MASK:
+ return 1;
+
+ case VG_MAX_COLOR_RAMP_STOPS:
+ return 1;
+ case VG_MAX_SCISSOR_RECTS:
+ case VG_MAX_DASH_COUNT:
+ case VG_MAX_KERNEL_SIZE:
+ case VG_MAX_SEPARABLE_KERNEL_SIZE:
+ case VG_MAX_IMAGE_WIDTH:
+ case VG_MAX_IMAGE_HEIGHT:
+ case VG_MAX_IMAGE_PIXELS:
+ case VG_MAX_IMAGE_BYTES:
+ case VG_MAX_FLOAT:
+ case VG_MAX_GAUSSIAN_STD_DEVIATION:
+ return 1;
+ default:
+ if (ctx)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return 0;
+ }
+}
+
+void vgGetfv(VGParamType type, VGint count,
+ VGfloat * values)
+{
+ const struct vg_state *state = current_state();
+ struct vg_context *ctx = vg_current_context();
+ VGint real_count = vgGetVectorSize(type);
+
+ if (!values || count <= 0 || count > real_count || !is_aligned(values)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ switch(type) {
+ case VG_MATRIX_MODE:
+ case VG_FILL_RULE:
+ case VG_IMAGE_QUALITY:
+ case VG_RENDERING_QUALITY:
+ case VG_BLEND_MODE:
+ case VG_IMAGE_MODE:
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM:
+#endif
+ case VG_STROKE_CAP_STYLE:
+ case VG_STROKE_JOIN_STYLE:
+ case VG_STROKE_DASH_PHASE_RESET:
+ case VG_MASKING:
+ case VG_SCISSORING:
+ case VG_PIXEL_LAYOUT:
+ case VG_SCREEN_LAYOUT:
+ case VG_FILTER_FORMAT_LINEAR:
+ case VG_FILTER_FORMAT_PREMULTIPLIED:
+ case VG_FILTER_CHANNEL_MASK:
+ case VG_MAX_SCISSOR_RECTS:
+ case VG_MAX_DASH_COUNT:
+ case VG_MAX_KERNEL_SIZE:
+ case VG_MAX_SEPARABLE_KERNEL_SIZE:
+ case VG_MAX_COLOR_RAMP_STOPS:
+ case VG_MAX_IMAGE_WIDTH:
+ case VG_MAX_IMAGE_HEIGHT:
+ case VG_MAX_IMAGE_PIXELS:
+ case VG_MAX_IMAGE_BYTES:
+ case VG_MAX_GAUSSIAN_STD_DEVIATION:
+ values[0] = vgGeti(type);
+ break;
+ case VG_MAX_FLOAT:
+ values[0] = vgGetf(type);
+ break;
+ case VG_SCISSOR_RECTS: {
+ VGint i;
+ for (i = 0; i < count; ++i) {
+ values[i] = state->scissor_rects[i].f;
+ }
+ }
+ break;
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM_VALUES: {
+ memcpy(values, state->color_transform_values,
+ sizeof(VGfloat) * count);
+ }
+ break;
+#endif
+ case VG_STROKE_LINE_WIDTH:
+ values[0] = state->stroke.line_width.f;
+ break;
+ case VG_STROKE_MITER_LIMIT:
+ values[0] = state->stroke.miter_limit.f;
+ break;
+ case VG_STROKE_DASH_PATTERN: {
+ VGint i;
+ for (i = 0; i < count; ++i) {
+ values[i] = state->stroke.dash_pattern[i].f;
+ }
+ }
+ break;
+ case VG_STROKE_DASH_PHASE:
+ values[0] = state->stroke.dash_phase.f;
+ break;
+ case VG_TILE_FILL_COLOR:
+ values[0] = state->tile_fill_color[0];
+ values[1] = state->tile_fill_color[1];
+ values[2] = state->tile_fill_color[2];
+ values[3] = state->tile_fill_color[3];
+ break;
+ case VG_CLEAR_COLOR:
+ values[0] = state->clear_color[0];
+ values[1] = state->clear_color[1];
+ values[2] = state->clear_color[2];
+ values[3] = state->clear_color[3];
+ break;
+#ifdef OPENVG_VERSION_1_1
+ case VG_GLYPH_ORIGIN:
+ values[0] = state->glyph_origin[0].f;
+ values[1] = state->glyph_origin[1].f;
+ break;
+#endif
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ }
+}
+
+void vgGetiv(VGParamType type, VGint count,
+ VGint * values)
+{
+ const struct vg_state *state = current_state();
+ struct vg_context *ctx = vg_current_context();
+ VGint real_count = vgGetVectorSize(type);
+
+ if (!values || count <= 0 || count > real_count || !is_aligned(values)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ switch(type) {
+ case VG_MATRIX_MODE:
+ case VG_FILL_RULE:
+ case VG_IMAGE_QUALITY:
+ case VG_RENDERING_QUALITY:
+ case VG_BLEND_MODE:
+ case VG_IMAGE_MODE:
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM:
+#endif
+ case VG_STROKE_CAP_STYLE:
+ case VG_STROKE_JOIN_STYLE:
+ case VG_STROKE_DASH_PHASE_RESET:
+ case VG_MASKING:
+ case VG_SCISSORING:
+ case VG_PIXEL_LAYOUT:
+ case VG_SCREEN_LAYOUT:
+ case VG_FILTER_FORMAT_LINEAR:
+ case VG_FILTER_FORMAT_PREMULTIPLIED:
+ case VG_FILTER_CHANNEL_MASK:
+ case VG_MAX_SCISSOR_RECTS:
+ case VG_MAX_DASH_COUNT:
+ case VG_MAX_KERNEL_SIZE:
+ case VG_MAX_SEPARABLE_KERNEL_SIZE:
+ case VG_MAX_COLOR_RAMP_STOPS:
+ case VG_MAX_IMAGE_WIDTH:
+ case VG_MAX_IMAGE_HEIGHT:
+ case VG_MAX_IMAGE_PIXELS:
+ case VG_MAX_IMAGE_BYTES:
+ case VG_MAX_GAUSSIAN_STD_DEVIATION:
+ values[0] = vgGeti(type);
+ break;
+ case VG_MAX_FLOAT: {
+ VGfloat val = vgGetf(type);
+ values[0] = float_to_int_floor(*((VGuint*)&val));
+ }
+ break;
+ case VG_SCISSOR_RECTS: {
+ VGint i;
+ for (i = 0; i < count; ++i) {
+ values[i] = state->scissor_rects[i].i;
+ }
+ }
+ break;
+#ifdef OPENVG_VERSION_1_1
+ case VG_COLOR_TRANSFORM_VALUES: {
+ VGint i;
+ VGuint *x = (VGuint*)state->color_transform_values;
+ for (i = 0; i < count; ++i) {
+ values[i] = float_to_int_floor(x[i]);
+ }
+ }
+ break;
+#endif
+ case VG_STROKE_LINE_WIDTH:
+ values[0] = state->stroke.line_width.i;
+ break;
+ case VG_STROKE_MITER_LIMIT:
+ values[0] = state->stroke.miter_limit.i;
+ break;
+ case VG_STROKE_DASH_PATTERN: {
+ VGint i;
+ for (i = 0; i < count; ++i) {
+ values[i] = state->stroke.dash_pattern[i].i;
+ }
+ }
+ break;
+ case VG_STROKE_DASH_PHASE:
+ values[0] = state->stroke.dash_phase.i;
+ break;
+ case VG_TILE_FILL_COLOR:
+ values[0] = state->tile_fill_colori[0];
+ values[1] = state->tile_fill_colori[1];
+ values[2] = state->tile_fill_colori[2];
+ values[3] = state->tile_fill_colori[3];
+ break;
+ case VG_CLEAR_COLOR:
+ values[0] = state->clear_colori[0];
+ values[1] = state->clear_colori[1];
+ values[2] = state->clear_colori[2];
+ values[3] = state->clear_colori[3];
+ break;
+#ifdef OPENVG_VERSION_1_1
+ case VG_GLYPH_ORIGIN:
+ values[0] = state->glyph_origin[0].i;
+ values[1] = state->glyph_origin[1].i;
+ break;
+#endif
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ }
+}
+
+void vgSetParameterf(VGHandle object,
+ VGint paramType,
+ VGfloat value)
+{
+ struct vg_context *ctx = vg_current_context();
+ void *ptr = (void*)object;
+
+ if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ switch(paramType) {
+ case VG_PAINT_TYPE:
+ case VG_PAINT_COLOR_RAMP_SPREAD_MODE:
+ case VG_PAINT_PATTERN_TILING_MODE:
+ vgSetParameteri(object, paramType, floor(value));
+ return;
+ break;
+ case VG_PAINT_COLOR:
+ case VG_PAINT_COLOR_RAMP_STOPS:
+ case VG_PAINT_LINEAR_GRADIENT:
+ case VG_PAINT_RADIAL_GRADIENT:
+ /* it's an error if paramType refers to a vector parameter */
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: {
+ struct vg_paint *p = (struct vg_paint *)object;
+ paint_set_color_ramp_premultiplied(p, value);
+ }
+ break;
+
+ case VG_PATH_DATATYPE:
+ case VG_PATH_FORMAT:
+ case VG_PATH_SCALE:
+ case VG_PATH_BIAS:
+ case VG_PATH_NUM_SEGMENTS:
+ case VG_PATH_NUM_COORDS:
+
+ case VG_IMAGE_FORMAT:
+ case VG_IMAGE_WIDTH:
+ case VG_IMAGE_HEIGHT:
+
+#ifdef OPENVG_VERSION_1_1
+ case VG_FONT_NUM_GLYPHS:
+ /* read only don't produce an error */
+ break;
+#endif
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ }
+}
+
+void vgSetParameteri(VGHandle object,
+ VGint paramType,
+ VGint value)
+{
+ struct vg_context *ctx = vg_current_context();
+ void *ptr = (void*)object;
+
+ if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ switch(paramType) {
+ case VG_PAINT_TYPE:
+ if (value < VG_PAINT_TYPE_COLOR ||
+ value > VG_PAINT_TYPE_PATTERN)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ struct vg_paint *paint = (struct vg_paint *)ptr;
+ paint_set_type(paint, value);
+ }
+ break;
+ case VG_PAINT_COLOR:
+ case VG_PAINT_COLOR_RAMP_STOPS:
+ case VG_PAINT_LINEAR_GRADIENT:
+ case VG_PAINT_RADIAL_GRADIENT:
+ /* it's an error if paramType refers to a vector parameter */
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ case VG_PAINT_COLOR_RAMP_SPREAD_MODE:
+ if (value < VG_COLOR_RAMP_SPREAD_PAD ||
+ value > VG_COLOR_RAMP_SPREAD_REFLECT)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ struct vg_paint *paint = (struct vg_paint *)ptr;
+ paint_set_spread_mode(paint, value);
+ }
+ break;
+ case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: {
+ struct vg_paint *p = (struct vg_paint *)object;
+ paint_set_color_ramp_premultiplied(p, value);
+ }
+ break;
+ case VG_PAINT_PATTERN_TILING_MODE:
+ if (value < VG_TILE_FILL ||
+ value > VG_TILE_REFLECT)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ struct vg_paint *paint = (struct vg_paint *)ptr;
+ paint_set_pattern_tiling(paint, value);
+ }
+ break;
+
+ case VG_PATH_DATATYPE:
+ case VG_PATH_FORMAT:
+ case VG_PATH_SCALE:
+ case VG_PATH_BIAS:
+ case VG_PATH_NUM_SEGMENTS:
+ case VG_PATH_NUM_COORDS:
+
+ case VG_IMAGE_FORMAT:
+ case VG_IMAGE_WIDTH:
+ case VG_IMAGE_HEIGHT:
+
+#ifdef OPENVG_VERSION_1_1
+ case VG_FONT_NUM_GLYPHS:
+ /* read only don't produce an error */
+ break;
+#endif
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+}
+
+void vgSetParameterfv(VGHandle object,
+ VGint paramType,
+ VGint count,
+ const VGfloat * values)
+{
+ struct vg_context *ctx = vg_current_context();
+ void *ptr = (void*)object;
+ VGint real_count = vgGetParameterVectorSize(object, paramType);
+
+ if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (count < 0 || count < real_count ||
+ (values == NULL && count != 0) ||
+ !is_aligned(values)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ switch(paramType) {
+ case VG_PAINT_TYPE:
+ case VG_PAINT_COLOR_RAMP_SPREAD_MODE:
+ case VG_PAINT_COLOR_RAMP_PREMULTIPLIED:
+ case VG_PAINT_PATTERN_TILING_MODE:
+ if (count != 1)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else
+ vgSetParameterf(object, paramType, values[0]);
+ return;
+ break;
+ case VG_PAINT_COLOR: {
+ if (count != 4)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_set_color(paint, values);
+ }
+ }
+ break;
+ case VG_PAINT_COLOR_RAMP_STOPS: {
+ if (count && count < 4)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ count = MIN2(count, VEGA_MAX_COLOR_RAMP_STOPS);
+ paint_set_ramp_stops(paint, values, count);
+ {
+ VGint stopsi[VEGA_MAX_COLOR_RAMP_STOPS];
+ int i = 0;
+ for (i = 0; i < count; ++i) {
+ stopsi[i] = float_to_int_floor(*((VGuint*)(values + i)));
+ }
+ paint_set_ramp_stopsi(paint, stopsi, count);
+ }
+ }
+ }
+ break;
+ case VG_PAINT_LINEAR_GRADIENT: {
+ if (count != 4)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_set_linear_gradient(paint, values);
+ {
+ VGint vals[4];
+ vals[0] = FLT_TO_INT(values[0]);
+ vals[1] = FLT_TO_INT(values[1]);
+ vals[2] = FLT_TO_INT(values[2]);
+ vals[3] = FLT_TO_INT(values[3]);
+ paint_set_linear_gradienti(paint, vals);
+ }
+ }
+ }
+ break;
+ case VG_PAINT_RADIAL_GRADIENT: {
+ if (count != 5)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_set_radial_gradient(paint, values);
+ {
+ VGint vals[5];
+ vals[0] = FLT_TO_INT(values[0]);
+ vals[1] = FLT_TO_INT(values[1]);
+ vals[2] = FLT_TO_INT(values[2]);
+ vals[3] = FLT_TO_INT(values[3]);
+ vals[4] = FLT_TO_INT(values[4]);
+ paint_set_radial_gradienti(paint, vals);
+ }
+ }
+ }
+ break;
+
+ case VG_PATH_DATATYPE:
+ case VG_PATH_FORMAT:
+ case VG_PATH_SCALE:
+ case VG_PATH_BIAS:
+ case VG_PATH_NUM_SEGMENTS:
+ case VG_PATH_NUM_COORDS:
+
+#ifdef OPENVG_VERSION_1_1
+ case VG_FONT_NUM_GLYPHS:
+ /* read only don't produce an error */
+ break;
+#endif
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+}
+
+void vgSetParameteriv(VGHandle object,
+ VGint paramType,
+ VGint count,
+ const VGint * values)
+{
+ struct vg_context *ctx = vg_current_context();
+ void *ptr = (void*)object;
+ VGint real_count = vgGetParameterVectorSize(object, paramType);
+
+ if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (count < 0 || count < real_count ||
+ (values == NULL && count != 0) ||
+ !is_aligned(values)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ switch(paramType) {
+ case VG_PAINT_TYPE:
+ case VG_PAINT_COLOR_RAMP_SPREAD_MODE:
+ case VG_PAINT_COLOR_RAMP_PREMULTIPLIED:
+ case VG_PAINT_PATTERN_TILING_MODE:
+ if (count != 1)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else
+ vgSetParameteri(object, paramType, values[0]);
+ return;
+ break;
+ case VG_PAINT_COLOR: {
+ if (count != 4)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_set_coloriv(paint, values);
+ }
+ }
+ break;
+ case VG_PAINT_COLOR_RAMP_STOPS: {
+ if ((count % 5))
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ VGfloat *vals = 0;
+ int i;
+ struct vg_paint *paint = (struct vg_paint *)object;
+ if (count) {
+ vals = malloc(sizeof(VGfloat)*count);
+ for (i = 0; i < count; ++i)
+ vals[i] = values[i];
+ }
+
+ paint_set_ramp_stopsi(paint, values, count);
+ paint_set_ramp_stops(paint, vals, count);
+ free(vals);
+ }
+ }
+ break;
+ case VG_PAINT_LINEAR_GRADIENT: {
+ if (count != 4)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ VGfloat vals[4];
+ struct vg_paint *paint = (struct vg_paint *)object;
+ vals[0] = values[0];
+ vals[1] = values[1];
+ vals[2] = values[2];
+ vals[3] = values[3];
+ paint_set_linear_gradient(paint, vals);
+ paint_set_linear_gradienti(paint, values);
+ }
+ }
+ break;
+ case VG_PAINT_RADIAL_GRADIENT: {
+ if (count != 5)
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ else {
+ VGfloat vals[5];
+ struct vg_paint *paint = (struct vg_paint *)object;
+ vals[0] = values[0];
+ vals[1] = values[1];
+ vals[2] = values[2];
+ vals[3] = values[3];
+ vals[4] = values[4];
+ paint_set_radial_gradient(paint, vals);
+ paint_set_radial_gradienti(paint, values);
+ }
+ }
+ break;
+ case VG_PATH_DATATYPE:
+ case VG_PATH_FORMAT:
+ case VG_PATH_SCALE:
+ case VG_PATH_BIAS:
+ case VG_PATH_NUM_SEGMENTS:
+ case VG_PATH_NUM_COORDS:
+ /* read only don't produce an error */
+ break;
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+}
+
+VGint vgGetParameterVectorSize(VGHandle object,
+ VGint paramType)
+{
+ struct vg_context *ctx = vg_current_context();
+ void *ptr = (void*)object;
+
+ if (!ptr || object == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return 0;
+ }
+
+ switch(paramType) {
+ case VG_PAINT_TYPE:
+ case VG_PAINT_COLOR_RAMP_SPREAD_MODE:
+ case VG_PAINT_COLOR_RAMP_PREMULTIPLIED:
+ case VG_PAINT_PATTERN_TILING_MODE:
+ return 1;
+ case VG_PAINT_COLOR:
+ return 4;
+ case VG_PAINT_COLOR_RAMP_STOPS: {
+ struct vg_paint *p = (struct vg_paint *)object;
+ return paint_num_ramp_stops(p);
+ }
+ break;
+ case VG_PAINT_LINEAR_GRADIENT:
+ return 4;
+ case VG_PAINT_RADIAL_GRADIENT:
+ return 5;
+
+
+ case VG_PATH_FORMAT:
+ case VG_PATH_DATATYPE:
+ case VG_PATH_SCALE:
+ case VG_PATH_BIAS:
+ case VG_PATH_NUM_SEGMENTS:
+ case VG_PATH_NUM_COORDS:
+ return 1;
+
+ case VG_IMAGE_FORMAT:
+ case VG_IMAGE_WIDTH:
+ case VG_IMAGE_HEIGHT:
+ return 1;
+
+#ifdef OPENVG_VERSION_1_1
+ case VG_FONT_NUM_GLYPHS:
+ return 1;
+#endif
+
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ }
+ return 0;
+}
+
+
+VGfloat vgGetParameterf(VGHandle object,
+ VGint paramType)
+{
+ struct vg_context *ctx = vg_current_context();
+ void *ptr = (void*)object;
+
+ if (!ptr || object == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return 0;
+ }
+
+ switch(paramType) {
+ case VG_PAINT_TYPE:
+ case VG_PAINT_COLOR_RAMP_SPREAD_MODE:
+ case VG_PAINT_COLOR_RAMP_PREMULTIPLIED:
+ case VG_PAINT_PATTERN_TILING_MODE:
+ return vgGetParameteri(object, paramType);
+ break;
+ case VG_PAINT_COLOR:
+ case VG_PAINT_COLOR_RAMP_STOPS:
+ case VG_PAINT_LINEAR_GRADIENT:
+ case VG_PAINT_RADIAL_GRADIENT:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+
+ case VG_PATH_FORMAT:
+ return VG_PATH_FORMAT_STANDARD;
+ case VG_PATH_SCALE: {
+ struct path *p = (struct path*)object;
+ return path_scale(p);
+ }
+ case VG_PATH_BIAS: {
+ struct path *p = (struct path*)object;
+ return path_bias(p);
+ }
+ case VG_PATH_DATATYPE:
+ case VG_PATH_NUM_SEGMENTS:
+ case VG_PATH_NUM_COORDS:
+ return vgGetParameteri(object, paramType);
+ break;
+
+ case VG_IMAGE_FORMAT:
+ case VG_IMAGE_WIDTH:
+ case VG_IMAGE_HEIGHT:
+#ifdef OPENVG_VERSION_1_1
+ case VG_FONT_NUM_GLYPHS:
+ return vgGetParameteri(object, paramType);
+ break;
+#endif
+
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ }
+ return 0;
+}
+
+VGint vgGetParameteri(VGHandle object,
+ VGint paramType)
+{
+ struct vg_context *ctx = vg_current_context();
+ void *ptr = (void*)object;
+
+ if (!ptr || object == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return 0;
+ }
+
+ switch(paramType) {
+ case VG_PAINT_TYPE: {
+ struct vg_paint *paint = (struct vg_paint *)ptr;
+ return paint_type(paint);
+ }
+ break;
+ case VG_PAINT_COLOR_RAMP_SPREAD_MODE: {
+ struct vg_paint *p = (struct vg_paint *)object;
+ return paint_spread_mode(p);
+ }
+ case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: {
+ struct vg_paint *p = (struct vg_paint *)object;
+ return paint_color_ramp_premultiplied(p);
+ }
+ break;
+ case VG_PAINT_PATTERN_TILING_MODE: {
+ struct vg_paint *p = (struct vg_paint *)object;
+ return paint_pattern_tiling(p);
+ }
+ break;
+ case VG_PAINT_COLOR:
+ case VG_PAINT_COLOR_RAMP_STOPS:
+ case VG_PAINT_LINEAR_GRADIENT:
+ case VG_PAINT_RADIAL_GRADIENT:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+
+ case VG_PATH_FORMAT:
+ return VG_PATH_FORMAT_STANDARD;
+ case VG_PATH_SCALE:
+ case VG_PATH_BIAS:
+ return vgGetParameterf(object, paramType);
+ case VG_PATH_DATATYPE: {
+ struct path *p = (struct path*)object;
+ return path_datatype(p);
+ }
+ case VG_PATH_NUM_SEGMENTS: {
+ struct path *p = (struct path*)object;
+ return path_num_segments(p);
+ }
+ case VG_PATH_NUM_COORDS: {
+ struct path *p = (struct path*)object;
+ return path_num_coords(p);
+ }
+ break;
+
+ case VG_IMAGE_FORMAT: {
+ struct vg_image *img = (struct vg_image*)object;
+ return img->format;
+ }
+ break;
+ case VG_IMAGE_WIDTH: {
+ struct vg_image *img = (struct vg_image*)object;
+ return img->width;
+ }
+ break;
+ case VG_IMAGE_HEIGHT: {
+ struct vg_image *img = (struct vg_image*)object;
+ return img->height;
+ }
+ break;
+
+#ifdef OPENVG_VERSION_1_1
+ case VG_FONT_NUM_GLYPHS: {
+ return 1;
+ }
+ break;
+#endif
+
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ }
+ return 0;
+}
+
+void vgGetParameterfv(VGHandle object,
+ VGint paramType,
+ VGint count,
+ VGfloat * values)
+{
+ struct vg_context *ctx = vg_current_context();
+ void *ptr = (void*)object;
+ VGint real_count = vgGetParameterVectorSize(object, paramType);
+
+ if (!ptr || object == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (!values || count <= 0 || count > real_count ||
+ !is_aligned(values)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ switch(paramType) {
+ case VG_PAINT_TYPE: {
+ struct vg_paint *p = (struct vg_paint *)object;
+ values[0] = paint_type(p);
+ }
+ break;
+ case VG_PAINT_COLOR_RAMP_SPREAD_MODE: {
+ struct vg_paint *p = (struct vg_paint *)object;
+ values[0] = paint_spread_mode(p);
+ }
+ break;
+ case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: {
+ struct vg_paint *p = (struct vg_paint *)object;
+ values[0] = paint_color_ramp_premultiplied(p);
+ }
+ break;
+ case VG_PAINT_PATTERN_TILING_MODE: {
+ values[0] = vgGetParameterf(object, paramType);
+ }
+ break;
+ case VG_PAINT_COLOR: {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_get_color(paint, values);
+ }
+ break;
+ case VG_PAINT_COLOR_RAMP_STOPS: {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_ramp_stops(paint, values, count);
+ }
+ break;
+ case VG_PAINT_LINEAR_GRADIENT: {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_linear_gradient(paint, values);
+ }
+ break;
+ case VG_PAINT_RADIAL_GRADIENT: {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_radial_gradient(paint, values);
+ }
+ break;
+
+ case VG_PATH_FORMAT:
+ case VG_PATH_DATATYPE:
+ case VG_PATH_NUM_SEGMENTS:
+ case VG_PATH_NUM_COORDS:
+ values[0] = vgGetParameteri(object, paramType);
+ break;
+ case VG_PATH_SCALE:
+ case VG_PATH_BIAS:
+ values[0] = vgGetParameterf(object, paramType);
+ break;
+
+ case VG_IMAGE_FORMAT:
+ case VG_IMAGE_WIDTH:
+ case VG_IMAGE_HEIGHT:
+#ifdef OPENVG_VERSION_1_1
+ case VG_FONT_NUM_GLYPHS:
+ values[0] = vgGetParameteri(object, paramType);
+ break;
+#endif
+
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ }
+}
+
+void vgGetParameteriv(VGHandle object,
+ VGint paramType,
+ VGint count,
+ VGint * values)
+{
+ struct vg_context *ctx = vg_current_context();
+ void *ptr = (void*)object;
+ VGint real_count = vgGetParameterVectorSize(object, paramType);
+
+ if (!ptr || object == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (!values || count <= 0 || count > real_count ||
+ !is_aligned(values)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ switch(paramType) {
+ case VG_PAINT_TYPE:
+ case VG_PAINT_COLOR_RAMP_SPREAD_MODE:
+ case VG_PAINT_COLOR_RAMP_PREMULTIPLIED:
+ case VG_PAINT_PATTERN_TILING_MODE:
+#ifdef OPENVG_VERSION_1_1
+ case VG_FONT_NUM_GLYPHS:
+ values[0] = vgGetParameteri(object, paramType);
+ break;
+#endif
+ case VG_PAINT_COLOR: {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_get_coloriv(paint, values);
+ }
+ break;
+ case VG_PAINT_COLOR_RAMP_STOPS: {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_ramp_stopsi(paint, values, count);
+ }
+ break;
+ case VG_PAINT_LINEAR_GRADIENT: {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_linear_gradienti(paint, values);
+ }
+ break;
+ case VG_PAINT_RADIAL_GRADIENT: {
+ struct vg_paint *paint = (struct vg_paint *)object;
+ paint_radial_gradienti(paint, values);
+ }
+ break;
+
+ case VG_PATH_SCALE:
+ case VG_PATH_BIAS:
+ values[0] = vgGetParameterf(object, paramType);
+ break;
+ case VG_PATH_FORMAT:
+ case VG_PATH_DATATYPE:
+ case VG_PATH_NUM_SEGMENTS:
+ case VG_PATH_NUM_COORDS:
+ values[0] = vgGetParameteri(object, paramType);
+ break;
+
+ case VG_IMAGE_FORMAT:
+ case VG_IMAGE_WIDTH:
+ case VG_IMAGE_HEIGHT:
+ values[0] = vgGetParameteri(object, paramType);
+ break;
+
+ default:
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ break;
+ }
+}
diff --git a/src/gallium/state_trackers/vega/api_path.c b/src/gallium/state_trackers/vega/api_path.c
new file mode 100644
index 00000000000..a6b7a2bb93a
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_path.c
@@ -0,0 +1,488 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "VG/openvg.h"
+
+#include "vg_context.h"
+#include "path.h"
+#include "polygon.h"
+#include "paint.h"
+
+#include "pipe/p_context.h"
+#include "pipe/p_inlines.h"
+#include "util/u_draw_quad.h"
+
+VGPath vgCreatePath(VGint pathFormat,
+ VGPathDatatype datatype,
+ VGfloat scale, VGfloat bias,
+ VGint segmentCapacityHint,
+ VGint coordCapacityHint,
+ VGbitfield capabilities)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (pathFormat != VG_PATH_FORMAT_STANDARD) {
+ vg_set_error(ctx, VG_UNSUPPORTED_PATH_FORMAT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+ if (datatype < VG_PATH_DATATYPE_S_8 ||
+ datatype > VG_PATH_DATATYPE_F) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+ if (!scale) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+
+ return (VGPath)path_create(datatype, scale, bias,
+ segmentCapacityHint, coordCapacityHint,
+ capabilities);
+}
+
+void vgClearPath(VGPath path, VGbitfield capabilities)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *p = 0;
+
+ if (path == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ p = (struct path *)path;
+ path_clear(p, capabilities);
+}
+
+void vgDestroyPath(VGPath p)
+{
+ struct path *path = 0;
+ struct vg_context *ctx = vg_current_context();
+
+ if (p == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ path = (struct path *)p;
+ path_destroy(path);
+}
+
+void vgRemovePathCapabilities(VGPath path,
+ VGbitfield capabilities)
+{
+ struct vg_context *ctx = vg_current_context();
+ VGbitfield current;
+ struct path *p;
+
+ if (path == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ p = (struct path*)path;
+ current = path_capabilities(p);
+ path_set_capabilities(p, (current &
+ (~(capabilities & VG_PATH_CAPABILITY_ALL))));
+}
+
+VGbitfield vgGetPathCapabilities(VGPath path)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *p = 0;
+
+ if (path == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return 0;
+ }
+ p = (struct path*)path;
+ return path_capabilities(p);
+}
+
+void vgAppendPath(VGPath dstPath, VGPath srcPath)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *src, *dst;
+
+ if (dstPath == VG_INVALID_HANDLE || srcPath == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ src = (struct path *)srcPath;
+ dst = (struct path *)dstPath;
+
+ if (!(path_capabilities(src) & VG_PATH_CAPABILITY_APPEND_FROM) ||
+ !(path_capabilities(dst) & VG_PATH_CAPABILITY_APPEND_TO)) {
+ vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR);
+ return;
+ }
+ path_append_path(dst, src);
+}
+
+void vgAppendPathData(VGPath dstPath,
+ VGint numSegments,
+ const VGubyte * pathSegments,
+ const void * pathData)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *p = 0;
+ VGint i;
+
+ if (dstPath == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (!pathSegments) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (numSegments <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ for (i = 0; i < numSegments; ++i) {
+ if (pathSegments[i] < VG_CLOSE_PATH ||
+ pathSegments[i] > VG_LCWARC_TO_REL) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ }
+
+ p = (struct path*)dstPath;
+
+ if (!pathData || !is_aligned_to(pathData, path_datatype_size(p))) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (!(path_capabilities(p)&VG_PATH_CAPABILITY_APPEND_TO)) {
+ vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR);
+ return;
+ }
+
+ path_append_data(p, numSegments, pathSegments, pathData);
+}
+
+void vgModifyPathCoords(VGPath dstPath,
+ VGint startIndex,
+ VGint numSegments,
+ const void * pathData)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *p = 0;
+
+ if (dstPath == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (startIndex < 0 || numSegments <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ p = (struct path *)dstPath;
+
+ if (!pathData || !is_aligned_to(pathData, path_datatype_size(p))) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (startIndex + numSegments > path_num_segments(p)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (!(path_capabilities(p)&VG_PATH_CAPABILITY_MODIFY)) {
+ vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR);
+ return;
+ }
+ path_modify_coords(p, startIndex, numSegments, pathData);
+}
+
+void vgTransformPath(VGPath dstPath, VGPath srcPath)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *src = 0, *dst = 0;
+
+ if (dstPath == VG_INVALID_HANDLE || srcPath == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ src = (struct path *)srcPath;
+ dst = (struct path *)dstPath;
+
+ if (!(path_capabilities(src) & VG_PATH_CAPABILITY_TRANSFORM_FROM) ||
+ !(path_capabilities(dst) & VG_PATH_CAPABILITY_TRANSFORM_TO)) {
+ vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR);
+ return;
+ }
+ path_transform(dst, src);
+}
+
+VGboolean vgInterpolatePath(VGPath dstPath,
+ VGPath startPath,
+ VGPath endPath,
+ VGfloat amount)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *start = 0, *dst = 0, *end = 0;
+
+ if (dstPath == VG_INVALID_HANDLE ||
+ startPath == VG_INVALID_HANDLE ||
+ endPath == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return VG_FALSE;
+ }
+ dst = (struct path *)dstPath;
+ start = (struct path *)startPath;
+ end = (struct path *)endPath;
+
+ if (!(path_capabilities(dst) & VG_PATH_CAPABILITY_INTERPOLATE_TO) ||
+ !(path_capabilities(start) & VG_PATH_CAPABILITY_INTERPOLATE_FROM) ||
+ !(path_capabilities(end) & VG_PATH_CAPABILITY_INTERPOLATE_FROM)) {
+ vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR);
+ return VG_FALSE;
+ }
+
+ return path_interpolate(dst,
+ start, end, amount);
+}
+
+VGfloat vgPathLength(VGPath path,
+ VGint startSegment,
+ VGint numSegments)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *p = 0;
+
+ if (path == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return -1;
+ }
+ if (startSegment < 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return -1;
+ }
+ if (numSegments <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return -1;
+ }
+ p = (struct path*)path;
+
+ if (!(path_capabilities(p) & VG_PATH_CAPABILITY_PATH_LENGTH)) {
+ vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR);
+ return -1;
+ }
+ if (startSegment + numSegments > path_num_segments(p)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return -1;
+ }
+
+ return path_length(p, startSegment, numSegments);
+}
+
+void vgPointAlongPath(VGPath path,
+ VGint startSegment,
+ VGint numSegments,
+ VGfloat distance,
+ VGfloat * x, VGfloat * y,
+ VGfloat * tangentX,
+ VGfloat * tangentY)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *p = 0;
+ VGbitfield caps;
+
+ if (path == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (startSegment < 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (numSegments <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (!is_aligned(x) || !is_aligned(y) ||
+ !is_aligned(tangentX) || !is_aligned(tangentY)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ p = (struct path*)path;
+
+ caps = path_capabilities(p);
+ if (!(caps & VG_PATH_CAPABILITY_POINT_ALONG_PATH) ||
+ !(caps & VG_PATH_CAPABILITY_TANGENT_ALONG_PATH)) {
+ vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR);
+ return;
+ }
+
+ if (startSegment + numSegments > path_num_segments(p)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ {
+ VGfloat point[2], normal[2];
+ path_point(p, startSegment, numSegments, distance,
+ point, normal);
+ if (x)
+ *x = point[0];
+ if (y)
+ *y = point[1];
+ if (tangentX)
+ *tangentX = -normal[1];
+ if (tangentY)
+ *tangentY = normal[0];
+ }
+}
+
+void vgPathBounds(VGPath path,
+ VGfloat * minX,
+ VGfloat * minY,
+ VGfloat * width,
+ VGfloat * height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *p = 0;
+ VGbitfield caps;
+
+ if (path == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (!minX || !minY || !width || !height) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (!is_aligned(minX) || !is_aligned(minY) ||
+ !is_aligned(width) || !is_aligned(height)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ p = (struct path*)path;
+
+ caps = path_capabilities(p);
+ if (!(caps & VG_PATH_CAPABILITY_PATH_BOUNDS)) {
+ vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR);
+ return;
+ }
+
+ path_bounding_rect(p, minX, minY, width, height);
+}
+
+void vgPathTransformedBounds(VGPath path,
+ VGfloat * minX,
+ VGfloat * minY,
+ VGfloat * width,
+ VGfloat * height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct path *p = 0;
+ VGbitfield caps;
+
+ if (path == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (!minX || !minY || !width || !height) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (!is_aligned(minX) || !is_aligned(minY) ||
+ !is_aligned(width) || !is_aligned(height)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ p = (struct path*)path;
+
+ caps = path_capabilities(p);
+ if (!(caps & VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS)) {
+ vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR);
+ return;
+ }
+
+#if 0
+ /* faster, but seems to have precision problems... */
+ path_bounding_rect(p, minX, minY, width, height);
+ if (*width > 0 && *height > 0) {
+ VGfloat pts[] = {*minX, *minY,
+ *minX + *width, *minY,
+ *minX + *width, *minY + *height,
+ *minX, *minY + *height};
+ struct matrix *matrix = &ctx->state.vg.path_user_to_surface_matrix;
+ VGfloat maxX, maxY;
+ matrix_map_point(matrix, pts[0], pts[1], pts + 0, pts + 1);
+ matrix_map_point(matrix, pts[2], pts[3], pts + 2, pts + 3);
+ matrix_map_point(matrix, pts[4], pts[5], pts + 4, pts + 5);
+ matrix_map_point(matrix, pts[6], pts[7], pts + 6, pts + 7);
+ *minX = MIN2(pts[0], MIN2(pts[2], MIN2(pts[4], pts[6])));
+ *minY = MIN2(pts[1], MIN2(pts[3], MIN2(pts[5], pts[7])));
+ maxX = MAX2(pts[0], MAX2(pts[2], MAX2(pts[4], pts[6])));
+ maxY = MAX2(pts[1], MAX2(pts[3], MAX2(pts[5], pts[7])));
+ *width = maxX - *minX;
+ *height = maxY - *minY;
+ }
+#else
+ {
+ struct path *dst = path_create(VG_PATH_DATATYPE_F, 1.0, 0,
+ 0, 0, VG_PATH_CAPABILITY_ALL);
+ path_transform(dst, p);
+ path_bounding_rect(dst, minX, minY, width, height);
+ path_destroy(dst);
+ }
+#endif
+}
+
+
+void vgDrawPath(VGPath path, VGbitfield paintModes)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (path == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ if (!(paintModes & (VG_STROKE_PATH | VG_FILL_PATH))) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (path_is_empty((struct path*)path))
+ return;
+ path_render((struct path*)path, paintModes);
+}
+
diff --git a/src/gallium/state_trackers/vega/api_text.c b/src/gallium/state_trackers/vega/api_text.c
new file mode 100644
index 00000000000..d8411cf3e87
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_text.c
@@ -0,0 +1,258 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "VG/openvg.h"
+
+#include "vg_context.h"
+
+#include "util/u_memory.h"
+
+#ifdef OPENVG_VERSION_1_1
+
+struct vg_font {
+ struct vg_object base;
+
+ VGint glyph_indices[200];
+ VGint num_glyphs;
+};
+
+VGFont vgCreateFont(VGint glyphCapacityHint)
+{
+ struct vg_font *font = 0;
+ struct vg_context *ctx = vg_current_context();
+
+ if (glyphCapacityHint < 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return VG_INVALID_HANDLE;
+ }
+
+ font = CALLOC_STRUCT(vg_font);
+ vg_init_object(&font->base, ctx, VG_OBJECT_FONT);
+ vg_context_add_object(ctx, VG_OBJECT_FONT, font);
+ return (VGFont)font;
+}
+
+void vgDestroyFont(VGFont f)
+{
+ struct vg_font *font = (struct vg_font *)f;
+ struct vg_context *ctx = vg_current_context();
+
+ if (f == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ vg_context_remove_object(ctx, VG_OBJECT_FONT, font);
+ /*free(font);*/
+}
+
+void vgSetGlyphToPath(VGFont font,
+ VGuint glyphIndex,
+ VGPath path,
+ VGboolean isHinted,
+ VGfloat glyphOrigin [2],
+ VGfloat escapement[2])
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_object *pathObj;
+ struct vg_font *f;
+
+ if (font == VG_INVALID_HANDLE ||
+ !vg_context_is_object_valid(ctx, VG_OBJECT_FONT, (void *)font)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (!glyphOrigin || !escapement ||
+ !is_aligned(glyphOrigin) || !is_aligned(escapement)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (path != VG_INVALID_HANDLE &&
+ !vg_context_is_object_valid(ctx, VG_OBJECT_PATH, (void *)path)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ pathObj = (struct vg_object*)path;
+ if (pathObj && pathObj->type != VG_OBJECT_PATH) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+
+ f = (struct vg_font*)font;
+ f->glyph_indices[f->num_glyphs] = glyphIndex;
+ ++f->num_glyphs;
+}
+
+void vgSetGlyphToImage(VGFont font,
+ VGuint glyphIndex,
+ VGImage image,
+ VGfloat glyphOrigin [2],
+ VGfloat escapement[2])
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_object *img_obj;
+ struct vg_font *f;
+
+ if (font == VG_INVALID_HANDLE ||
+ !vg_context_is_object_valid(ctx, VG_OBJECT_FONT, (void *)font)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (!glyphOrigin || !escapement ||
+ !is_aligned(glyphOrigin) || !is_aligned(escapement)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (image != VG_INVALID_HANDLE &&
+ !vg_context_is_object_valid(ctx, VG_OBJECT_IMAGE, (void *)image)) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ img_obj = (struct vg_object*)image;
+ if (img_obj && img_obj->type != VG_OBJECT_IMAGE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ f = (struct vg_font*)font;
+ f->glyph_indices[f->num_glyphs] = glyphIndex;
+ ++f->num_glyphs;
+}
+
+static INLINE VGboolean font_contains_glyph(struct vg_font *font,
+ VGuint glyph_index)
+{
+ VGint i;
+ for (i = 0; i < font->num_glyphs; ++i) {
+ if (font->glyph_indices[i] == glyph_index) {
+ return VG_TRUE;
+ }
+ }
+ return VG_FALSE;
+}
+
+void vgClearGlyph(VGFont font,
+ VGuint glyphIndex)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_font *f;
+ VGint i;
+
+ if (font == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (glyphIndex <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ f = (struct vg_font*)font;
+ if (!font_contains_glyph(f, glyphIndex)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ for (i = 0; i < f->num_glyphs; ++i) {
+ if (f->glyph_indices[i] == glyphIndex) {
+ /*FIXME*/
+ f->glyph_indices[f->num_glyphs] = 0;
+ --f->num_glyphs;
+ return;
+ }
+ }
+}
+
+void vgDrawGlyph(VGFont font,
+ VGuint glyphIndex,
+ VGbitfield paintModes,
+ VGboolean allowAutoHinting)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_font *f;
+
+ if (font == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (glyphIndex <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (paintModes & (~(VG_STROKE_PATH|VG_FILL_PATH))) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ f = (struct vg_font*)font;
+ if (!font_contains_glyph(f, glyphIndex)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+}
+
+void vgDrawGlyphs(VGFont font,
+ VGint glyphCount,
+ VGuint *glyphIndices,
+ VGfloat *adjustments_x,
+ VGfloat *adjustments_y,
+ VGbitfield paintModes,
+ VGboolean allowAutoHinting)
+{
+ struct vg_context *ctx = vg_current_context();
+ VGint i;
+ struct vg_font *f;
+
+ if (font == VG_INVALID_HANDLE) {
+ vg_set_error(ctx, VG_BAD_HANDLE_ERROR);
+ return;
+ }
+ if (glyphCount <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (!glyphIndices || !is_aligned(glyphIndices)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (!adjustments_x || !is_aligned(adjustments_x) ||
+ !adjustments_y || !is_aligned(adjustments_y)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ if (paintModes & (~(VG_STROKE_PATH|VG_FILL_PATH))) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ f = (struct vg_font*)font;
+ for (i = 0; i < glyphCount; ++i) {
+ VGuint glyph_index = glyphIndices[i];
+ if (!font_contains_glyph(f, glyph_index)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ }
+}
+
+#endif
diff --git a/src/gallium/state_trackers/vega/api_transform.c b/src/gallium/state_trackers/vega/api_transform.c
new file mode 100644
index 00000000000..763a5ec415c
--- /dev/null
+++ b/src/gallium/state_trackers/vega/api_transform.c
@@ -0,0 +1,128 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "VG/openvg.h"
+
+#include "vg_context.h"
+
+#include "matrix.h"
+
+void vgLoadIdentity(void)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct matrix *mat = vg_state_matrix(&ctx->state.vg);
+ matrix_load_identity(mat);
+}
+
+void vgLoadMatrix(const VGfloat * m)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct matrix *mat;
+
+ if (!ctx)
+ return;
+
+ if (!m || !is_aligned(m)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ mat = vg_state_matrix(&ctx->state.vg);
+ matrix_init(mat, m);
+ if (!matrix_is_affine(mat)) {
+ if (ctx->state.vg.matrix_mode != VG_MATRIX_IMAGE_USER_TO_SURFACE) {
+ matrix_make_affine(mat);
+ }
+ }
+}
+
+void vgGetMatrix(VGfloat * m)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct matrix *mat;
+
+ if (!ctx)
+ return;
+
+ if (!m || !is_aligned(m)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ mat = vg_state_matrix(&ctx->state.vg);
+ memcpy(m, mat->m, sizeof(VGfloat)*9);
+}
+
+void vgMultMatrix(const VGfloat * m)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct matrix *dst, src;
+
+ if (!ctx)
+ return;
+
+ if (!m || !is_aligned(m)) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ matrix_init(&src, m);
+ dst = vg_state_matrix(&ctx->state.vg);
+ if (!matrix_is_affine(&src)) {
+ if (ctx->state.vg.matrix_mode != VG_MATRIX_IMAGE_USER_TO_SURFACE) {
+ matrix_make_affine(&src);
+ }
+ }
+ matrix_mult(dst, &src);
+
+}
+
+void vgTranslate(VGfloat tx, VGfloat ty)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct matrix *dst = vg_state_matrix(&ctx->state.vg);
+ matrix_translate(dst, tx, ty);
+}
+
+void vgScale(VGfloat sx, VGfloat sy)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct matrix *dst = vg_state_matrix(&ctx->state.vg);
+ matrix_scale(dst, sx, sy);
+}
+
+void vgShear(VGfloat shx, VGfloat shy)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct matrix *dst = vg_state_matrix(&ctx->state.vg);
+ matrix_shear(dst, shx, shy);
+}
+
+void vgRotate(VGfloat angle)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct matrix *dst = vg_state_matrix(&ctx->state.vg);
+ matrix_rotate(dst, angle);
+}
diff --git a/src/gallium/state_trackers/vega/arc.c b/src/gallium/state_trackers/vega/arc.c
new file mode 100644
index 00000000000..e74c7f03345
--- /dev/null
+++ b/src/gallium/state_trackers/vega/arc.c
@@ -0,0 +1,708 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "arc.h"
+
+#include "matrix.h"
+#include "bezier.h"
+#include "polygon.h"
+#include "stroker.h"
+#include "path.h"
+
+#include "util/u_debug.h"
+
+#include <math.h>
+
+#ifndef M_PI
+#define M_PI 3.14159265358979323846
+#endif
+
+#define DEBUG_ARCS 0
+
+static const VGfloat two_pi = M_PI * 2;
+
+
+static const double coeffs3Low[2][4][4] = {
+ {
+ { 3.85268, -21.229, -0.330434, 0.0127842 },
+ { -1.61486, 0.706564, 0.225945, 0.263682 },
+ { -0.910164, 0.388383, 0.00551445, 0.00671814 },
+ { -0.630184, 0.192402, 0.0098871, 0.0102527 }
+ },
+ {
+ { -0.162211, 9.94329, 0.13723, 0.0124084 },
+ { -0.253135, 0.00187735, 0.0230286, 0.01264 },
+ { -0.0695069, -0.0437594, 0.0120636, 0.0163087 },
+ { -0.0328856, -0.00926032, -0.00173573, 0.00527385 }
+ }
+};
+
+/* coefficients for error estimation
+ while using cubic Bézier curves for approximation
+ 1/4 <= b/a <= 1 */
+static const double coeffs3High[2][4][4] = {
+ {
+ { 0.0899116, -19.2349, -4.11711, 0.183362 },
+ { 0.138148, -1.45804, 1.32044, 1.38474 },
+ { 0.230903, -0.450262, 0.219963, 0.414038 },
+ { 0.0590565, -0.101062, 0.0430592, 0.0204699 }
+ },
+ {
+ { 0.0164649, 9.89394, 0.0919496, 0.00760802 },
+ { 0.0191603, -0.0322058, 0.0134667, -0.0825018 },
+ { 0.0156192, -0.017535, 0.00326508, -0.228157 },
+ { -0.0236752, 0.0405821, -0.0173086, 0.176187 }
+ }
+};
+
+/* safety factor to convert the "best" error approximation
+ into a "max bound" error */
+static const double safety3[] = {
+ 0.001, 4.98, 0.207, 0.0067
+};
+
+/* The code below is from the OpenVG 1.1 Spec
+ * Section 18.4 */
+
+/* Given: Points (x0, y0) and (x1, y1)
+ * Return: TRUE if a solution exists, FALSE otherwise
+ * Circle centers are written to (cx0, cy0) and (cx1, cy1)
+ */
+static VGboolean
+find_unit_circles(double x0, double y0, double x1, double y1,
+ double *cx0, double *cy0,
+ double *cx1, double *cy1)
+{
+ /* Compute differences and averages */
+ double dx = x0 - x1;
+ double dy = y0 - y1;
+ double xm = (x0 + x1)/2;
+ double ym = (y0 + y1)/2;
+ double dsq, disc, s, sdx, sdy;
+
+ /* Solve for intersecting unit circles */
+ dsq = dx*dx + dy*dy;
+ if (dsq == 0.0) return VG_FALSE; /* Points are coincident */
+ disc = 1.0/dsq - 1.0/4.0;
+
+ /* the precision we care about here is around float so if we're
+ * around the float defined zero then make it official to avoid
+ * precision problems later on */
+ if (floatIsZero(disc))
+ disc = 0.0;
+
+ if (disc < 0.0) return VG_FALSE; /* Points are too far apart */
+ s = sqrt(disc);
+ sdx = s*dx;
+ sdy = s*dy;
+ *cx0 = xm + sdy;
+ *cy0 = ym - sdx;
+ *cx1 = xm - sdy;
+ *cy1 = ym + sdx;
+ return VG_TRUE;
+}
+
+
+/* Given: Ellipse parameters rh, rv, rot (in degrees),
+ * endpoints (x0, y0) and (x1, y1)
+ * Return: TRUE if a solution exists, FALSE otherwise
+ * Ellipse centers are written to (cx0, cy0) and (cx1, cy1)
+ */
+static VGboolean
+find_ellipses(double rh, double rv, double rot,
+ double x0, double y0, double x1, double y1,
+ double *cx0, double *cy0, double *cx1, double *cy1)
+{
+ double COS, SIN, x0p, y0p, x1p, y1p, pcx0, pcy0, pcx1, pcy1;
+ /* Convert rotation angle from degrees to radians */
+ rot *= M_PI/180.0;
+ /* Pre-compute rotation matrix entries */
+ COS = cos(rot); SIN = sin(rot);
+ /* Transform (x0, y0) and (x1, y1) into unit space */
+ /* using (inverse) rotate, followed by (inverse) scale */
+ x0p = (x0*COS + y0*SIN)/rh;
+ y0p = (-x0*SIN + y0*COS)/rv;
+ x1p = (x1*COS + y1*SIN)/rh;
+ y1p = (-x1*SIN + y1*COS)/rv;
+ if (!find_unit_circles(x0p, y0p, x1p, y1p,
+ &pcx0, &pcy0, &pcx1, &pcy1)) {
+ return VG_FALSE;
+ }
+ /* Transform back to original coordinate space */
+ /* using (forward) scale followed by (forward) rotate */
+ pcx0 *= rh; pcy0 *= rv;
+ pcx1 *= rh; pcy1 *= rv;
+ *cx0 = pcx0*COS - pcy0*SIN;
+ *cy0 = pcx0*SIN + pcy0*COS;
+ *cx1 = pcx1*COS - pcy1*SIN;
+ *cy1 = pcx1*SIN + pcy1*COS;
+ return VG_TRUE;
+}
+
+static INLINE VGboolean
+try_to_fix_radii(struct arc *arc)
+{
+ double COS, SIN, rot, x0p, y0p, x1p, y1p;
+ double dx, dy, dsq, scale;
+
+ /* Convert rotation angle from degrees to radians */
+ rot = DEGREES_TO_RADIANS(arc->theta);
+
+ /* Pre-compute rotation matrix entries */
+ COS = cos(rot); SIN = sin(rot);
+
+ /* Transform (x0, y0) and (x1, y1) into unit space */
+ /* using (inverse) rotate, followed by (inverse) scale */
+ x0p = (arc->x1*COS + arc->y1*SIN)/arc->a;
+ y0p = (-arc->x1*SIN + arc->y1*COS)/arc->b;
+ x1p = (arc->x2*COS + arc->y2*SIN)/arc->a;
+ y1p = (-arc->x2*SIN + arc->y2*COS)/arc->b;
+ /* Compute differences and averages */
+ dx = x0p - x1p;
+ dy = y0p - y1p;
+
+ dsq = dx*dx + dy*dy;
+#if 0
+ if (dsq <= 0.001) {
+ debug_printf("AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAaaaaa\n");
+ }
+#endif
+ scale = 1/(2/sqrt(dsq));
+ arc->a *= scale;
+ arc->b *= scale;
+ return VG_TRUE;
+}
+
+static INLINE double vector_normalize(double *v)
+{
+ double sq = v[0] * v[0] + v[1] * v[1];
+ return sqrt(sq);
+}
+static INLINE double vector_orientation(double *v)
+{
+ double norm = vector_normalize(v);
+ double cosa = v[0] / norm;
+ double sina = v[1] / norm;
+ return (sina>=0 ? acos(cosa) : 2*M_PI - acos(cosa));
+}
+static INLINE double vector_dot(double *v0,
+ double *v1)
+{
+ return v0[0] * v1[0] + v0[1] * v1[1];
+}
+
+static INLINE double vector_angles(double *v0,
+ double *v1)
+{
+ double dot = vector_dot(v0, v1);
+ double norm0 = vector_normalize(v0);
+ double norm1 = vector_normalize(v1);
+
+ return acos(dot / (norm0 * norm1));
+}
+
+static VGboolean find_angles(struct arc *arc)
+{
+ double vec0[2], vec1[2];
+ double lambda1, lambda2;
+ double angle;
+ struct matrix matrix;
+
+ if (floatIsZero(arc->a) || floatIsZero(arc->b)) {
+ return VG_FALSE;
+ }
+ /* map the points to an identity circle */
+ matrix_load_identity(&matrix);
+ matrix_scale(&matrix, 1.f, arc->a/arc->b);
+ matrix_rotate(&matrix, -arc->theta);
+ matrix_map_point(&matrix,
+ arc->x1, arc->y1,
+ &arc->x1, &arc->y1);
+ matrix_map_point(&matrix,
+ arc->x2, arc->y2,
+ &arc->x2, &arc->y2);
+ matrix_map_point(&matrix,
+ arc->cx, arc->cy,
+ &arc->cx, &arc->cy);
+
+#if DEBUG_ARCS
+ debug_printf("Matrix 3 [%f, %f, %f| %f, %f, %f| %f, %f, %f]\n",
+ matrix.m[0], matrix.m[1], matrix.m[2],
+ matrix.m[3], matrix.m[4], matrix.m[5],
+ matrix.m[6], matrix.m[7], matrix.m[8]);
+ debug_printf("Endpoints [%f, %f], [%f, %f]\n",
+ arc->x1, arc->y1, arc->x2, arc->y2);
+#endif
+
+ vec0[0] = arc->x1 - arc->cx;
+ vec0[1] = arc->y1 - arc->cy;
+ vec1[0] = arc->x2 - arc->cx;
+ vec1[1] = arc->y2 - arc->cy;
+
+#if DEBUG_ARCS
+ debug_printf("Vec is [%f, %f], [%f, %f], [%f, %f]\n",
+ vec0[0], vec0[1], vec1[0], vec1[1], arc->cx, arc->cy);
+#endif
+
+ lambda1 = vector_orientation(vec0);
+
+ if (isnan(lambda1))
+ lambda1 = 0.f;
+
+ if (arc->type == VG_SCWARC_TO ||
+ arc->type == VG_SCCWARC_TO)
+ angle = vector_angles(vec0, vec1);
+ else if (arc->type == VG_LCWARC_TO ||
+ arc->type == VG_LCCWARC_TO) {
+ angle = 2*M_PI - vector_angles(vec0, vec1);
+ } else
+ abort();
+
+ if (isnan(angle))
+ angle = M_PI;
+
+
+ if (arc->type == VG_SCWARC_TO ||
+ arc->type == VG_LCWARC_TO)
+ lambda2 = lambda1 - angle;
+ else
+ lambda2 = lambda1 + angle;
+
+#if DEBUG_ARCS
+ debug_printf("Angle is %f and (%f, %f)\n", angle, lambda1, lambda2);
+#endif
+
+#if 0
+ arc->eta1 = atan2(sin(lambda1) / arc->b,
+ cos(lambda1) / arc->a);
+ arc->eta2 = atan2(sin(lambda2) / arc->b,
+ cos(lambda2) / arc->a);
+
+ /* make sure we have eta1 <= eta2 <= eta1 + 2 PI */
+ arc->eta2 -= two_pi * floor((arc->eta2 - arc->eta1) / two_pi);
+
+ /* the preceding correction fails if we have exactly et2 - eta1 = 2 PI
+ it reduces the interval to zero length */
+ if ((lambda2 - lambda1 > M_PI) && (arc->eta2 - arc->eta1 < M_PI)) {
+ arc->eta2 += 2 * M_PI;
+ }
+#else
+ arc->eta1 = lambda1;
+ arc->eta2 = lambda2;
+#endif
+
+ return VG_TRUE;
+}
+
+#if DEBUG_ARCS
+static void check_endpoints(struct arc *arc)
+{
+ double x1, y1, x2, y2;
+
+ double a_cos_eta1 = arc->a * cos(arc->eta1);
+ double b_sin_eta1 = arc->b * sin(arc->eta1);
+ x1 = arc->cx + a_cos_eta1 * arc->cos_theta -
+ b_sin_eta1 * arc->sin_theta;
+ y1 = arc->cy + a_cos_eta1 * arc->sin_theta +
+ b_sin_eta1 * arc->cos_theta;
+
+ double a_cos_eta2 = arc->a * cos(arc->eta2);
+ double b_sin_eta2 = arc->b * sin(arc->eta2);
+ x2 = arc->cx + a_cos_eta2 * arc->cos_theta -
+ b_sin_eta2 * arc->sin_theta;
+ y2 = arc->cy + a_cos_eta2 * arc->sin_theta +
+ b_sin_eta2 * arc->cos_theta;
+
+ debug_printf("Computed (%f, %f), (%f, %f)\n",
+ x1, y1, x2, y2);
+ debug_printf("Real (%f, %f), (%f, %f)\n",
+ arc->x1, arc->y1,
+ arc->x2, arc->y2);
+}
+#endif
+
+void arc_init(struct arc *arc,
+ VGPathSegment type,
+ VGfloat x1, VGfloat y1,
+ VGfloat x2, VGfloat y2,
+ VGfloat rh, VGfloat rv,
+ VGfloat rot)
+{
+ assert(type == VG_SCCWARC_TO ||
+ type == VG_SCWARC_TO ||
+ type == VG_LCCWARC_TO ||
+ type == VG_LCWARC_TO);
+ arc->type = type;
+ arc->x1 = x1;
+ arc->y1 = y1;
+ arc->x2 = x2;
+ arc->y2 = y2;
+ arc->a = rh;
+ arc->b = rv;
+ arc->theta = rot;
+ arc->cos_theta = cos(arc->theta);
+ arc->sin_theta = sin(arc->theta);
+ {
+ double cx0, cy0, cx1, cy1;
+ double cx, cy;
+ arc->is_valid = find_ellipses(rh, rv, rot, x1, y1, x2, y2,
+ &cx0, &cy0, &cx1, &cy1);
+
+ if (!arc->is_valid && try_to_fix_radii(arc)) {
+ rh = arc->a;
+ rv = arc->b;
+ arc->is_valid =
+ find_ellipses(rh, rv, rot, x1, y1, x2, y2,
+ &cx0, &cy0, &cx1, &cy1);
+ }
+
+ if (type == VG_SCWARC_TO ||
+ type == VG_LCCWARC_TO) {
+ cx = cx1;
+ cy = cy1;
+ } else {
+ cx = cx0;
+ cy = cy0;
+ }
+#if DEBUG_ARCS
+ debug_printf("Centers are : (%f, %f) , (%f, %f). Real (%f, %f)\n",
+ cx0, cy0, cx1, cy1, cx, cy);
+#endif
+ arc->cx = cx;
+ arc->cy = cy;
+ if (arc->is_valid) {
+ arc->is_valid = find_angles(arc);
+#if DEBUG_ARCS
+ check_endpoints(arc);
+#endif
+ /* remap a few points. find_angles requires
+ * rot in angles, the rest of the code
+ * will need them in radians. and find_angles
+ * modifies the center to match an identity
+ * circle so lets reset it */
+ arc->theta = DEGREES_TO_RADIANS(rot);
+ arc->cos_theta = cos(arc->theta);
+ arc->sin_theta = sin(arc->theta);
+ arc->cx = cx;
+ arc->cy = cy;
+ }
+ }
+}
+
+static INLINE double rational_function(double x, const double *c)
+{
+ return (x * (x * c[0] + c[1]) + c[2]) / (x + c[3]);
+}
+
+static double estimate_error(struct arc *arc,
+ double etaA, double etaB)
+{
+ double eta = 0.5 * (etaA + etaB);
+
+ double x = arc->b / arc->a;
+ double dEta = etaB - etaA;
+ double cos2 = cos(2 * eta);
+ double cos4 = cos(4 * eta);
+ double cos6 = cos(6 * eta);
+ double c0, c1;
+
+ /* select the right coeficients set according to degree and b/a */
+ const double (*coeffs)[4][4];
+ const double *safety;
+ coeffs = (x < 0.25) ? coeffs3Low : coeffs3High;
+ safety = safety3;
+
+ c0 = rational_function(x, coeffs[0][0])
+ + cos2 * rational_function(x, coeffs[0][1])
+ + cos4 * rational_function(x, coeffs[0][2])
+ + cos6 * rational_function(x, coeffs[0][3]);
+
+ c1 = rational_function(x, coeffs[1][0])
+ + cos2 * rational_function(x, coeffs[1][1])
+ + cos4 * rational_function(x, coeffs[1][2])
+ + cos6 * rational_function(x, coeffs[1][3]);
+
+ return rational_function(x, safety) * arc->a * exp(c0 + c1 * dEta);
+}
+
+struct arc_cb {
+ void (*move)(struct arc_cb *cb, VGfloat x, VGfloat y);
+ void (*point)(struct arc_cb *cb, VGfloat x, VGfloat y);
+ void (*bezier)(struct arc_cb *cb, struct bezier *bezier);
+
+ void *user_data;
+};
+
+static void cb_null_move(struct arc_cb *cb, VGfloat x, VGfloat y)
+{
+}
+
+static void polygon_point(struct arc_cb *cb, VGfloat x, VGfloat y)
+{
+ struct polygon *poly = (struct polygon*)cb->user_data;
+ polygon_vertex_append(poly, x, y);
+}
+
+static void polygon_bezier(struct arc_cb *cb, struct bezier *bezier)
+{
+ struct polygon *poly = (struct polygon*)cb->user_data;
+ bezier_add_to_polygon(bezier, poly);
+}
+
+static void stroke_point(struct arc_cb *cb, VGfloat x, VGfloat y)
+{
+ struct stroker *stroker = (struct stroker*)cb->user_data;
+ stroker_line_to(stroker, x, y);
+}
+
+static void stroke_curve(struct arc_cb *cb, struct bezier *bezier)
+{
+ struct stroker *stroker = (struct stroker*)cb->user_data;
+ stroker_curve_to(stroker,
+ bezier->x2, bezier->y2,
+ bezier->x3, bezier->y3,
+ bezier->x4, bezier->y4);
+}
+
+static void stroke_emit_point(struct arc_cb *cb, VGfloat x, VGfloat y)
+{
+ struct stroker *stroker = (struct stroker*)cb->user_data;
+ stroker_emit_line_to(stroker, x, y);
+}
+
+static void stroke_emit_curve(struct arc_cb *cb, struct bezier *bezier)
+{
+ struct stroker *stroker = (struct stroker*)cb->user_data;
+ stroker_emit_curve_to(stroker,
+ bezier->x2, bezier->y2,
+ bezier->x3, bezier->y3,
+ bezier->x4, bezier->y4);
+}
+
+static void arc_path_move(struct arc_cb *cb, VGfloat x, VGfloat y)
+{
+ struct path *path = (struct path*)cb->user_data;
+ path_move_to(path, x, y);
+}
+
+static void arc_path_point(struct arc_cb *cb, VGfloat x, VGfloat y)
+{
+ struct path *path = (struct path*)cb->user_data;
+ path_line_to(path, x, y);
+}
+
+static void arc_path_bezier(struct arc_cb *cb, struct bezier *bezier)
+{
+ struct path *path = (struct path*)cb->user_data;
+ path_cubic_to(path,
+ bezier->x2, bezier->y2,
+ bezier->x3, bezier->y3,
+ bezier->x4, bezier->y4);
+}
+
+static INLINE int num_beziers_needed(struct arc *arc)
+{
+ double threshold = 0.05;
+ VGboolean found = VG_FALSE;
+ int n = 1;
+ double min_eta, max_eta;
+
+ min_eta = MIN2(arc->eta1, arc->eta2);
+ max_eta = MAX2(arc->eta1, arc->eta2);
+
+ while ((! found) && (n < 1024)) {
+ double d_eta = (max_eta - min_eta) / n;
+ if (d_eta <= 0.5 * M_PI) {
+ double eta_b = min_eta;
+ found = VG_TRUE;
+ for (int i = 0; found && (i < n); ++i) {
+ double etaA = eta_b;
+ eta_b += d_eta;
+ found = (estimate_error(arc, etaA, eta_b) <= threshold);
+ }
+ }
+ n = n << 1;
+ }
+
+ return n;
+}
+
+static void arc_to_beziers(struct arc *arc,
+ struct arc_cb cb,
+ struct matrix *matrix)
+{
+ int n = 1;
+ double d_eta, eta_b, cos_eta_b,
+ sin_eta_b, a_cos_eta_b, b_sin_eta_b, a_sin_eta_b,
+ b_cos_eta_b, x_b, y_b, x_b_dot, y_b_dot, lx, ly;
+ double t, alpha;
+
+ { /* always move to the start of the arc */
+ VGfloat x = arc->x1;
+ VGfloat y = arc->y1;
+ matrix_map_point(matrix, x, y, &x, &y);
+ cb.move(&cb, x, y);
+ }
+
+ if (!arc->is_valid) {
+ VGfloat x = arc->x2;
+ VGfloat y = arc->y2;
+ matrix_map_point(matrix, x, y, &x, &y);
+ cb.point(&cb, x, y);
+ return;
+ }
+
+ /* find the number of Bézier curves needed */
+ n = num_beziers_needed(arc);
+
+ d_eta = (arc->eta2 - arc->eta1) / n;
+ eta_b = arc->eta1;
+
+ cos_eta_b = cos(eta_b);
+ sin_eta_b = sin(eta_b);
+ a_cos_eta_b = arc->a * cos_eta_b;
+ b_sin_eta_b = arc->b * sin_eta_b;
+ a_sin_eta_b = arc->a * sin_eta_b;
+ b_cos_eta_b = arc->b * cos_eta_b;
+ x_b = arc->cx + a_cos_eta_b * arc->cos_theta -
+ b_sin_eta_b * arc->sin_theta;
+ y_b = arc->cy + a_cos_eta_b * arc->sin_theta +
+ b_sin_eta_b * arc->cos_theta;
+ x_b_dot = -a_sin_eta_b * arc->cos_theta -
+ b_cos_eta_b * arc->sin_theta;
+ y_b_dot = -a_sin_eta_b * arc->sin_theta +
+ b_cos_eta_b * arc->cos_theta;
+
+ {
+ VGfloat x = x_b, y = y_b;
+ matrix_map_point(matrix, x, y, &x, &y);
+ cb.point(&cb, x, y);
+ }
+ lx = x_b;
+ ly = y_b;
+
+ t = tan(0.5 * d_eta);
+ alpha = sin(d_eta) * (sqrt(4 + 3 * t * t) - 1) / 3;
+
+ for (int i = 0; i < n; ++i) {
+ struct bezier bezier;
+ double xA = x_b;
+ double yA = y_b;
+ double xADot = x_b_dot;
+ double yADot = y_b_dot;
+
+ eta_b += d_eta;
+ cos_eta_b = cos(eta_b);
+ sin_eta_b = sin(eta_b);
+ a_cos_eta_b = arc->a * cos_eta_b;
+ b_sin_eta_b = arc->b * sin_eta_b;
+ a_sin_eta_b = arc->a * sin_eta_b;
+ b_cos_eta_b = arc->b * cos_eta_b;
+ x_b = arc->cx + a_cos_eta_b * arc->cos_theta -
+ b_sin_eta_b * arc->sin_theta;
+ y_b = arc->cy + a_cos_eta_b * arc->sin_theta +
+ b_sin_eta_b * arc->cos_theta;
+ x_b_dot = -a_sin_eta_b * arc->cos_theta -
+ b_cos_eta_b * arc->sin_theta;
+ y_b_dot = -a_sin_eta_b * arc->sin_theta +
+ b_cos_eta_b * arc->cos_theta;
+
+ bezier_init(&bezier,
+ lx, ly,
+ (float) (xA + alpha * xADot), (float) (yA + alpha * yADot),
+ (float) (x_b - alpha * x_b_dot), (float) (y_b - alpha * y_b_dot),
+ (float) x_b, (float) y_b);
+#if 0
+ debug_printf("%d) Bezier (%f, %f), (%f, %f), (%f, %f), (%f, %f)\n",
+ i,
+ bezier.x1, bezier.y1,
+ bezier.x2, bezier.y2,
+ bezier.x3, bezier.y3,
+ bezier.x4, bezier.y4);
+#endif
+ bezier_transform(&bezier, matrix);
+ cb.bezier(&cb, &bezier);
+ lx = x_b;
+ ly = y_b;
+ }
+}
+
+
+void arc_add_to_polygon(struct arc *arc,
+ struct polygon *poly,
+ struct matrix *matrix)
+{
+ struct arc_cb cb;
+
+ cb.move = cb_null_move;
+ cb.point = polygon_point;
+ cb.bezier = polygon_bezier;
+ cb.user_data = poly;
+
+ arc_to_beziers(arc, cb, matrix);
+}
+
+void arc_stroke_cb(struct arc *arc,
+ struct stroker *stroke,
+ struct matrix *matrix)
+{
+ struct arc_cb cb;
+
+ cb.move = cb_null_move;
+ cb.point = stroke_point;
+ cb.bezier = stroke_curve;
+ cb.user_data = stroke;
+
+ arc_to_beziers(arc, cb, matrix);
+}
+
+void arc_stroker_emit(struct arc *arc,
+ struct stroker *stroker,
+ struct matrix *matrix)
+{
+ struct arc_cb cb;
+
+ cb.move = cb_null_move;
+ cb.point = stroke_emit_point;
+ cb.bezier = stroke_emit_curve;
+ cb.user_data = stroker;
+
+ arc_to_beziers(arc, cb, matrix);
+}
+
+void arc_to_path(struct arc *arc,
+ struct path *path,
+ struct matrix *matrix)
+{
+ struct arc_cb cb;
+
+ cb.move = arc_path_move;
+ cb.point = arc_path_point;
+ cb.bezier = arc_path_bezier;
+ cb.user_data = path;
+
+ arc_to_beziers(arc, cb, matrix);
+}
diff --git a/src/gallium/state_trackers/vega/arc.h b/src/gallium/state_trackers/vega/arc.h
new file mode 100644
index 00000000000..3205cd5021d
--- /dev/null
+++ b/src/gallium/state_trackers/vega/arc.h
@@ -0,0 +1,80 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef ARC_H
+#define ARC_H
+
+#include "VG/openvg.h"
+
+struct polygon;
+struct matrix;
+struct stroker;
+struct path;
+
+struct arc {
+ VGPathSegment type;
+
+ VGfloat cx, cy;
+
+ VGfloat a, b;
+
+ VGfloat theta;
+ VGfloat cos_theta, sin_theta;
+
+ VGfloat eta1;
+ VGfloat eta2;
+
+ VGfloat x1, y1, x2, y2;
+
+ VGboolean is_valid;
+};
+
+void arc_init(struct arc *arc,
+ VGPathSegment type,
+ VGfloat x1, VGfloat y1,
+ VGfloat x2, VGfloat y2,
+ VGfloat rh, VGfloat rv,
+ VGfloat rot);
+
+void arc_add_to_polygon(struct arc *arc,
+ struct polygon *poly,
+ struct matrix *matrix);
+
+
+void arc_to_path(struct arc *arc,
+ struct path *p,
+ struct matrix *matrix);
+
+void arc_stroke_cb(struct arc *arc,
+ struct stroker *stroke,
+ struct matrix *matrix);
+
+void arc_stroker_emit(struct arc *arc,
+ struct stroker *stroke,
+ struct matrix *matrix);
+
+
+#endif
diff --git a/src/gallium/state_trackers/vega/asm_fill.h b/src/gallium/state_trackers/vega/asm_fill.h
new file mode 100644
index 00000000000..2f394ad6c55
--- /dev/null
+++ b/src/gallium/state_trackers/vega/asm_fill.h
@@ -0,0 +1,246 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef ASM_FILL_H
+#define ASM_FILL_H
+
+static const char solid_fill_asm[] =
+ "MOV %s, CONST[0]\n";
+
+
+static const char linear_grad_asm[] =
+ "MOV TEMP[0].xy, IN[0]\n"
+ "MOV TEMP[0].z, CONST[1].yyyy\n"
+ "DP3 TEMP[1], CONST[2], TEMP[0]\n"
+ "DP3 TEMP[2], CONST[3], TEMP[0]\n"
+ "DP3 TEMP[3], CONST[4], TEMP[0]\n"
+ "RCP TEMP[3], TEMP[3]\n"
+ "MUL TEMP[1], TEMP[1], TEMP[3]\n"
+ "MUL TEMP[2], TEMP[2], TEMP[3]\n"
+ "MOV TEMP[4].x, TEMP[1]\n"
+ "MOV TEMP[4].y, TEMP[2]\n"
+ "MUL TEMP[0], CONST[0].yyyy, TEMP[4].yyyy\n"
+ "MAD TEMP[1], CONST[0].xxxx, TEMP[4].xxxx, TEMP[0]\n"
+ "MUL TEMP[2], TEMP[1], CONST[0].zzzz\n"
+ "TEX %s, TEMP[2], SAMP[0], 1D\n";
+
+static const char radial_grad_asm[] =
+ "MOV TEMP[0].xy, IN[0]\n"
+ "MOV TEMP[0].z, CONST[1].yyyy\n"
+ "DP3 TEMP[1], CONST[2], TEMP[0]\n"
+ "DP3 TEMP[2], CONST[3], TEMP[0]\n"
+ "DP3 TEMP[3], CONST[4], TEMP[0]\n"
+ "RCP TEMP[3], TEMP[3]\n"
+ "MUL TEMP[1], TEMP[1], TEMP[3]\n"
+ "MUL TEMP[2], TEMP[2], TEMP[3]\n"
+ "MOV TEMP[5].x, TEMP[1]\n"
+ "MOV TEMP[5].y, TEMP[2]\n"
+ "MUL TEMP[0], CONST[0].yyyy, TEMP[5].yyyy\n"
+ "MAD TEMP[1], CONST[0].xxxx, TEMP[5].xxxx, TEMP[0]\n"
+ "ADD TEMP[1], TEMP[1], TEMP[1]\n"
+ "MUL TEMP[3], TEMP[5].yyyy, TEMP[5].yyyy\n"
+ "MAD TEMP[4], TEMP[5].xxxx, TEMP[5].xxxx, TEMP[3]\n"
+ "MOV TEMP[4], -TEMP[4]\n"
+ "MUL TEMP[2], CONST[0].zzzz, TEMP[4]\n"
+ "MUL TEMP[0], CONST[1].wwww, TEMP[2]\n"
+ "MUL TEMP[3], TEMP[1], TEMP[1]\n"
+ "SUB TEMP[2], TEMP[3], TEMP[0]\n"
+ "RSQ TEMP[2], |TEMP[2]|\n"
+ "RCP TEMP[2], TEMP[2]\n"
+ "SUB TEMP[1], TEMP[2], TEMP[1]\n"
+ "ADD TEMP[0], CONST[0].zzzz, CONST[0].zzzz\n"
+ "RCP TEMP[0], TEMP[0]\n"
+ "MUL TEMP[2], TEMP[1], TEMP[0]\n"
+ "TEX %s, TEMP[2], SAMP[0], 1D\n";
+
+static const char pattern_asm[] =
+ "MOV TEMP[0].xy, IN[0]\n"
+ "MOV TEMP[0].z, CONST[1].yyyy\n"
+ "DP3 TEMP[1], CONST[2], TEMP[0]\n"
+ "DP3 TEMP[2], CONST[3], TEMP[0]\n"
+ "DP3 TEMP[3], CONST[4], TEMP[0]\n"
+ "RCP TEMP[3], TEMP[3]\n"
+ "MUL TEMP[1], TEMP[1], TEMP[3]\n"
+ "MUL TEMP[2], TEMP[2], TEMP[3]\n"
+ "MOV TEMP[4].x, TEMP[1]\n"
+ "MOV TEMP[4].y, TEMP[2]\n"
+ "RCP TEMP[0], CONST[1].zwzw\n"
+ "MOV TEMP[1], TEMP[4]\n"
+ "MUL TEMP[1].x, TEMP[1], TEMP[0]\n"
+ "MUL TEMP[1].y, TEMP[1], TEMP[0]\n"
+ "TEX %s, TEMP[1], SAMP[0], 2D\n";
+
+
+static const char mask_asm[] =
+ "TEX TEMP[1], IN[0], SAMP[1], 2D\n"
+ "MUL TEMP[0].w, TEMP[0].wwww, TEMP[1].wwww\n"
+ "MOV %s, TEMP[0]\n";
+
+
+static const char image_normal_asm[] =
+ "TEX %s, IN[1], SAMP[3], 2D\n";
+
+static const char image_multiply_asm[] =
+ "TEX TEMP[1], IN[1], SAMP[3], 2D\n"
+ "MUL %s, TEMP[0], TEMP[1]\n";
+
+static const char image_stencil_asm[] =
+ "TEX TEMP[1], IN[1], SAMP[3], 2D\n"
+ "MUL %s, TEMP[0], TEMP[1]\n";
+
+
+#define EXTENDED_BLEND_OVER \
+ "SUB TEMP[3], CONST[1].yyyy, TEMP[1].wwww\n" \
+ "SUB TEMP[4], CONST[1].yyyy, TEMP[0].wwww\n" \
+ "MUL TEMP[3], TEMP[0], TEMP[3]\n" \
+ "MUL TEMP[4], TEMP[1], TEMP[4]\n" \
+ "ADD TEMP[3], TEMP[3], TEMP[4]\n"
+
+static const char blend_multiply_asm[] =
+ "TEX TEMP[1], IN[0], SAMP[2], 2D\n"
+ EXTENDED_BLEND_OVER
+ "MUL TEMP[4], TEMP[0], TEMP[1]\n"
+ "ADD TEMP[1], TEMP[4], TEMP[3]\n"/*result.rgb*/
+ "MUL TEMP[2], TEMP[0].wwww, TEMP[1].wwww\n"
+ "ADD TEMP[3], TEMP[0].wwww, TEMP[1].wwww\n"
+ "SUB TEMP[1].w, TEMP[3], TEMP[2]\n"
+ "MOV %s, TEMP[1]\n";
+#if 1
+static const char blend_screen_asm[] =
+ "TEX TEMP[1], IN[0], SAMP[2], 2D\n"
+ "ADD TEMP[3], TEMP[0], TEMP[1]\n"
+ "MUL TEMP[2], TEMP[0], TEMP[1]\n"
+ "SUB %s, TEMP[3], TEMP[2]\n";
+#else
+static const char blend_screen_asm[] =
+ "TEX TEMP[1], IN[0], SAMP[2], 2D\n"
+ "MOV %s, TEMP[1]\n";
+#endif
+
+static const char blend_darken_asm[] =
+ "TEX TEMP[1], IN[0], SAMP[2], 2D\n"
+ EXTENDED_BLEND_OVER
+ "MUL TEMP[4], TEMP[0], TEMP[1].wwww\n"
+ "MUL TEMP[5], TEMP[1], TEMP[0].wwww\n"
+ "MIN TEMP[4], TEMP[4], TEMP[5]\n"
+ "ADD TEMP[1], TEMP[3], TEMP[4]\n"
+ "MUL TEMP[2], TEMP[0].wwww, TEMP[1].wwww\n"
+ "ADD TEMP[3], TEMP[0].wwww, TEMP[1].wwww\n"
+ "SUB TEMP[1].w, TEMP[3], TEMP[2]\n"
+ "MOV %s, TEMP[1]\n";
+
+static const char blend_lighten_asm[] =
+ "TEX TEMP[1], IN[0], SAMP[2], 2D\n"
+ EXTENDED_BLEND_OVER
+ "MUL TEMP[4], TEMP[0], TEMP[1].wwww\n"
+ "MUL TEMP[5], TEMP[1], TEMP[0].wwww\n"
+ "MAX TEMP[4], TEMP[4], TEMP[5]\n"
+ "ADD TEMP[1], TEMP[3], TEMP[4]\n"
+ "MUL TEMP[2], TEMP[0].wwww, TEMP[1].wwww\n"
+ "ADD TEMP[3], TEMP[0].wwww, TEMP[1].wwww\n"
+ "SUB TEMP[1].w, TEMP[3], TEMP[2]\n"
+ "MOV %s, TEMP[1]\n";
+
+
+static const char premultiply_asm[] =
+ "MUL TEMP[0].xyz, TEMP[0], TEMP[0].wwww\n";
+
+static const char unpremultiply_asm[] =
+ "TEX TEMP[0], IN[0], SAMP[1], 2D\n";
+
+
+static const char color_bw_asm[] =
+ "ADD TEMP[1], CONST[1].yyyy, CONST[1].yyyy\n"
+ "RCP TEMP[2], TEMP[1]\n"
+ "ADD TEMP[1], CONST[1].yyyy, TEMP[2]\n"
+ "ADD TEMP[2].x, TEMP[0].xxxx, TEMP[0].yyyy\n"
+ "ADD TEMP[2].x, TEMP[0].zzzz, TEMP[0].xxxx\n"
+ "SGE TEMP[0].xyz, TEMP[2].xxxx, TEMP[1]\n"
+ "SGE TEMP[0].w, TEMP[0].wwww, TEMP[2].yyyy\n"
+ "MOV %s, TEMP[0]\n";
+
+
+struct shader_asm_info {
+ VGint id;
+ VGint num_tokens;
+ const char * txt;
+
+ VGboolean needs_position;
+
+ VGint start_const;
+ VGint num_consts;
+
+ VGint start_sampler;
+ VGint num_samplers;
+
+ VGint start_temp;
+ VGint num_temps;
+};
+
+
+static const struct shader_asm_info shaders_asm[] = {
+ /* fills */
+ {VEGA_SOLID_FILL_SHADER, 40, solid_fill_asm,
+ VG_FALSE, 0, 1, 0, 0, 0, 0},
+ {VEGA_LINEAR_GRADIENT_SHADER, 200, linear_grad_asm,
+ VG_TRUE, 0, 5, 0, 1, 0, 5},
+ {VEGA_RADIAL_GRADIENT_SHADER, 200, radial_grad_asm,
+ VG_TRUE, 0, 5, 0, 1, 0, 6},
+ {VEGA_PATTERN_SHADER, 100, pattern_asm,
+ VG_TRUE, 1, 4, 0, 1, 0, 5},
+
+ /* image draw modes */
+ {VEGA_IMAGE_NORMAL_SHADER, 200, image_normal_asm,
+ VG_TRUE, 0, 0, 3, 1, 0, 0},
+ {VEGA_IMAGE_MULTIPLY_SHADER, 200, image_multiply_asm,
+ VG_TRUE, 0, 0, 3, 1, 0, 2},
+ {VEGA_IMAGE_STENCIL_SHADER, 200, image_stencil_asm,
+ VG_TRUE, 0, 0, 3, 1, 0, 2},
+
+ {VEGA_MASK_SHADER, 100, mask_asm,
+ VG_TRUE, 0, 0, 1, 1, 0, 2},
+
+ /* extra blend modes */
+ {VEGA_BLEND_MULTIPLY_SHADER, 200, blend_multiply_asm,
+ VG_TRUE, 1, 1, 2, 1, 0, 5},
+ {VEGA_BLEND_SCREEN_SHADER, 200, blend_screen_asm,
+ VG_TRUE, 0, 0, 2, 1, 0, 4},
+ {VEGA_BLEND_DARKEN_SHADER, 200, blend_darken_asm,
+ VG_TRUE, 1, 1, 2, 1, 0, 6},
+ {VEGA_BLEND_LIGHTEN_SHADER, 200, blend_lighten_asm,
+ VG_TRUE, 1, 1, 2, 1, 0, 6},
+
+ /* premultiply */
+ {VEGA_PREMULTIPLY_SHADER, 100, premultiply_asm,
+ VG_FALSE, 0, 0, 0, 0, 0, 1},
+ {VEGA_UNPREMULTIPLY_SHADER, 100, unpremultiply_asm,
+ VG_FALSE, 0, 0, 0, 0, 0, 1},
+
+ /* color transform to black and white */
+ {VEGA_BW_SHADER, 150, color_bw_asm,
+ VG_FALSE, 1, 1, 0, 0, 0, 3},
+};
+#endif
diff --git a/src/gallium/state_trackers/vega/asm_filters.h b/src/gallium/state_trackers/vega/asm_filters.h
new file mode 100644
index 00000000000..49807b9ab41
--- /dev/null
+++ b/src/gallium/state_trackers/vega/asm_filters.h
@@ -0,0 +1,117 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef ASM_FILTERS_H
+#define ASM_FILTERS_H
+
+static const char color_matrix_asm[] =
+ "FRAG1.1\n"
+ "DCL IN[0], GENERIC[0], PERSPECTIVE\n"
+ "DCL OUT[0], COLOR, CONSTANT\n"
+ "DCL CONST[0..4], CONSTANT\n"
+ "DCL TEMP[0..4], CONSTANT\n"
+ "DCL SAMP[0], CONSTANT\n"
+ "TEX TEMP[0], IN[0], SAMP[0], 2D\n"
+ "MOV TEMP[1], TEMP[0].xxxx\n"
+ "MOV TEMP[2], TEMP[0].yyyy\n"
+ "MOV TEMP[3], TEMP[0].zzzz\n"
+ "MOV TEMP[4], TEMP[0].wwww\n"
+ "MUL TEMP[1], TEMP[1], CONST[0]\n"
+ "MUL TEMP[2], TEMP[2], CONST[1]\n"
+ "MUL TEMP[3], TEMP[3], CONST[2]\n"
+ "MUL TEMP[4], TEMP[4], CONST[3]\n"
+ "ADD TEMP[0], TEMP[1], CONST[4]\n"
+ "ADD TEMP[0], TEMP[0], TEMP[2]\n"
+ "ADD TEMP[0], TEMP[0], TEMP[3]\n"
+ "ADD TEMP[0], TEMP[0], TEMP[4]\n"
+ "MOV OUT[0], TEMP[0]\n"
+ "END\n";
+
+static const char convolution_asm[] =
+ "FRAG1.1\n"
+ "DCL IN[0], GENERIC[0], PERSPECTIVE\n"
+ "DCL OUT[0], COLOR, CONSTANT\n"
+ "DCL TEMP[0..4], CONSTANT\n"
+ "DCL ADDR[0], CONSTANT\n"
+ "DCL CONST[0..%d], CONSTANT\n"
+ "DCL SAMP[0], CONSTANT\n"
+ "0: MOV TEMP[0], CONST[0].xxxx\n"
+ "1: MOV TEMP[1], CONST[0].xxxx\n"
+ "2: BGNLOOP2 :14\n"
+ "3: SGE TEMP[0].z, TEMP[0].yyyy, CONST[1].xxxx\n"
+ "4: IF TEMP[0].zzzz :7\n"
+ "5: BRK\n"
+ "6: ENDIF\n"
+ "7: ARL ADDR[0].x, TEMP[0].yyyy\n"
+ "8: MOV TEMP[3], CONST[ADDR[0]+2]\n"
+ "9: ADD TEMP[4].xy, IN[0], TEMP[3]\n"
+ "10: TEX TEMP[2], TEMP[4], SAMP[0], 2D\n"
+ "11: MOV TEMP[3], CONST[ADDR[0]+%d]\n"
+ "12: MAD TEMP[1], TEMP[2], TEMP[3], TEMP[1]\n"
+ "13: ADD TEMP[0].y, TEMP[0].yyyy, CONST[0].yyyy\n"
+ "14: ENDLOOP2 :2\n"
+ "15: MAD OUT[0], TEMP[1], CONST[1].yyyy, CONST[1].zzzz\n"
+ "16: END\n";
+
+
+static const char lookup_asm[] =
+ "FRAG1.1\n"
+ "DCL IN[0], GENERIC[0], PERSPECTIVE\n"
+ "DCL OUT[0], COLOR, CONSTANT\n"
+ "DCL TEMP[0..2], CONSTANT\n"
+ "DCL CONST[0], CONSTANT\n"
+ "DCL SAMP[0..1], CONSTANT\n"
+ "TEX TEMP[0], IN[0], SAMP[0], 2D\n"
+ "MOV TEMP[1], TEMP[0]\n"
+ /* do red */
+ "TEX TEMP[2], TEMP[1].xxxx, SAMP[1], 1D\n"
+ "MOV TEMP[0].x, TEMP[2].xxxx\n"
+ /* do blue */
+ "TEX TEMP[2], TEMP[1].yyyy, SAMP[1], 1D\n"
+ "MOV TEMP[0].y, TEMP[2].yyyy\n"
+ /* do green */
+ "TEX TEMP[2], TEMP[1].zzzz, SAMP[1], 1D\n"
+ "MOV TEMP[0].z, TEMP[2].zzzz\n"
+ /* do alpha */
+ "TEX TEMP[2], TEMP[1].wwww, SAMP[1], 1D\n"
+ "MOV TEMP[0].w, TEMP[2].wwww\n"
+ "MOV OUT[0], TEMP[0]\n"
+ "END\n";
+
+
+static const char lookup_single_asm[] =
+ "FRAG1.1\n"
+ "DCL IN[0], GENERIC[0], PERSPECTIVE\n"
+ "DCL OUT[0], COLOR, CONSTANT\n"
+ "DCL TEMP[0..2], CONSTANT\n"
+ "DCL CONST[0], CONSTANT\n"
+ "DCL SAMP[0..1], CONSTANT\n"
+ "TEX TEMP[0], IN[0], SAMP[0], 2D\n"
+ "TEX TEMP[1], TEMP[0].%s, SAMP[1], 1D\n"
+ "MOV OUT[0], TEMP[1]\n"
+ "END\n";
+
+#endif
diff --git a/src/gallium/state_trackers/vega/asm_util.h b/src/gallium/state_trackers/vega/asm_util.h
new file mode 100644
index 00000000000..218e1d166db
--- /dev/null
+++ b/src/gallium/state_trackers/vega/asm_util.h
@@ -0,0 +1,136 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef ASM_UTIL_H
+#define ASM_UTIL_H
+
+
+static const char pass_through_depth_asm[] =
+ "FRAG1.1\n"
+ "DCL IN[0], POSITION, LINEAR\n"
+ "DCL OUT[0].z, POSITION, CONSTANT\n"
+ "0: MOV OUT[0].z, IN[0].zzzz\n"
+ "1: END\n";
+
+
+
+/* μnew = μmask */
+static const char set_mask_asm[] =
+ "FRAG1.1\n"
+ "DCL IN[0], GENERIC[0], PERSPECTIVE\n"
+ "DCL SAMP[0], CONSTANT\n"
+ "DCL OUT[0], COLOR, CONSTANT\n"
+ "0: TEX OUT[0], IN[0], SAMP[0], 2D\n"/*umask*/
+ "1: END\n";
+
+/* μnew = 1 – (1 – μmask)*(1 – μprev) */
+static const char union_mask_asm[] =
+ "FRAG1.1\n"
+ "DCL IN[0], GENERIC[0], PERSPECTIVE\n"
+ "DCL IN[1], POSITION, LINEAR\n"
+ "DCL CONST[0], CONSTANT\n"
+ "DCL SAMP[0..1], CONSTANT\n"
+ "DCL TEMP[0..3], CONSTANT\n"
+ "DCL OUT[0], COLOR, CONSTANT\n"
+ "0: TEX TEMP[1], IN[0], SAMP[0], 2D\n"/*umask*/
+ "1: TEX TEMP[0], IN[1], SAMP[1], 2D\n"/*uprev*/
+ "2: SUB TEMP[2], CONST[0], TEMP[0]\n"
+ "3: SUB TEMP[3], CONST[0], TEMP[1]\n"
+ "4: MUL TEMP[0].w, TEMP[2].wwww, TEMP[3].wwww\n"
+ "5: SUB OUT[0], CONST[0], TEMP[0]\n"
+ "6: END\n";
+
+/* μnew = μmask *μprev */
+static const char intersect_mask_asm[] =
+ "FRAG1.1\n"
+ "DCL IN[0], GENERIC[0], PERSPECTIVE\n"
+ "DCL IN[1], POSITION, LINEAR\n"
+ "DCL CONST[0], CONSTANT\n"
+ "DCL SAMP[0..1], CONSTANT\n"
+ "DCL TEMP[0..1], CONSTANT\n"
+ "DCL OUT[0], COLOR, CONSTANT\n"
+ "0: TEX TEMP[0], IN[1], SAMP[1], 2D\n"/*uprev*/
+ "1: TEX TEMP[1], IN[0], SAMP[0], 2D\n"/*umask*/
+ "2: MUL OUT[0], TEMP[0].wwww, TEMP[1].wwww\n"
+ "3: END\n";
+
+/* μnew = μprev*(1 – μmask) */
+static const char subtract_mask_asm[] =
+ "FRAG1.1\n"
+ "DCL IN[0], GENERIC[0], PERSPECTIVE\n"
+ "DCL IN[1], POSITION, LINEAR\n"
+ "DCL CONST[0], CONSTANT\n"
+ "DCL SAMP[0..1], CONSTANT\n"
+ "DCL TEMP[0..2], CONSTANT\n"
+ "DCL OUT[0], COLOR, CONSTANT\n"
+ "0: TEX TEMP[1], IN[0], SAMP[0], 2D\n"/*umask*/
+ "1: TEX TEMP[0], IN[1], SAMP[1], 2D\n"/*uprev*/
+ "2: SUB TEMP[2], CONST[0], TEMP[1]\n"
+ "3: MUL OUT[0], TEMP[2].wwww, TEMP[0].wwww\n"
+ "4: END\n";
+
+
+static const char vs_plain_asm[] =
+ "VERT1.1\n"
+ "DCL IN[0]\n"
+ "DCL OUT[0], POSITION\n"
+ "DCL TEMP[0]\n"
+ "DCL CONST[0..1]\n"
+ "0: MUL TEMP[0], IN[0], CONST[0]\n"
+ "1: ADD TEMP[0], TEMP[0], CONST[1]\n"
+ "2: MOV OUT[0], TEMP[0]\n"
+ "3: END\n";
+
+static const char vs_clear_asm[] =
+ "VERT1.1\n"
+ "DCL IN[0]\n"
+ "DCL IN[1]\n"
+ "DCL OUT[0], POSITION\n"
+ "DCL OUT[1], COLOR\n"
+ "DCL TEMP[0]\n"
+ "DCL CONST[0..1]\n"
+ "0: MUL TEMP[0], IN[0], CONST[0]\n"
+ "1: ADD TEMP[0], TEMP[0], CONST[1]\n"
+ "2: MOV OUT[0], TEMP[0]\n"
+ "3: MOV OUT[1], IN[1]\n"
+ "4: END\n";
+
+
+static const char vs_texture_asm[] =
+ "VERT1.1\n"
+ "DCL IN[0]\n"
+ "DCL IN[1]\n"
+ "DCL OUT[0], POSITION\n"
+ "DCL OUT[1], GENERIC\n"
+ "DCL TEMP[0]\n"
+ "DCL CONST[0..1]\n"
+ "0: MUL TEMP[0], IN[0], CONST[0]\n"
+ "1: ADD TEMP[0], TEMP[0], CONST[1]\n"
+ "2: MOV OUT[0], TEMP[0]\n"
+ "3: MOV OUT[1], IN[1]\n"
+ "4: END\n";
+
+#endif
diff --git a/src/gallium/state_trackers/vega/bezier.c b/src/gallium/state_trackers/vega/bezier.c
new file mode 100644
index 00000000000..39a7ade0161
--- /dev/null
+++ b/src/gallium/state_trackers/vega/bezier.c
@@ -0,0 +1,704 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "bezier.h"
+
+#include "matrix.h"
+#include "polygon.h"
+
+#include "pipe/p_compiler.h"
+#include "util/u_debug.h"
+
+#include <stdlib.h>
+#include <stdio.h>
+#include <assert.h>
+#include <math.h>
+
+static const float flatness = 0.5;
+
+
+static INLINE void split_left(struct bezier *bez, VGfloat t, struct bezier* left)
+{
+ left->x1 = bez->x1;
+ left->y1 = bez->y1;
+
+ left->x2 = bez->x1 + t * (bez->x2 - bez->x1);
+ left->y2 = bez->y1 + t * (bez->y2 - bez->y1);
+
+ left->x3 = bez->x2 + t * (bez->x3 - bez->x2);
+ left->y3 = bez->y2 + t * (bez->y3 - bez->y2);
+
+ bez->x3 = bez->x3 + t * (bez->x4 - bez->x3);
+ bez->y3 = bez->y3 + t * (bez->y4 - bez->y3);
+
+ bez->x2 = left->x3 + t * (bez->x3 - left->x3);
+ bez->y2 = left->y3 + t * (bez->y3 - left->y3);
+
+ left->x3 = left->x2 + t * (left->x3 - left->x2);
+ left->y3 = left->y2 + t * (left->y3 - left->y2);
+
+ left->x4 = bez->x1 = left->x3 + t * (bez->x2 - left->x3);
+ left->y4 = bez->y1 = left->y3 + t * (bez->y2 - left->y3);
+}
+
+static INLINE void split(struct bezier *bez,
+ struct bezier *first_half,
+ struct bezier *second_half)
+{
+ double c = (bez->x2 + bez->x3) * 0.5;
+ first_half->x2 = (bez->x1 + bez->x2) * 0.5;
+ second_half->x3 = (bez->x3 + bez->x4) * 0.5;
+ first_half->x1 = bez->x1;
+ second_half->x4 = bez->x4;
+ first_half->x3 = (first_half->x2 + c) * 0.5;
+ second_half->x2 = (second_half->x3 + c) * 0.5;
+ first_half->x4 = second_half->x1 =
+ (first_half->x3 + second_half->x2) * 0.5;
+
+ c = (bez->y2 + bez->y3) / 2;
+ first_half->y2 = (bez->y1 + bez->y2) * 0.5;
+ second_half->y3 = (bez->y3 + bez->y4) * 0.5;
+ first_half->y1 = bez->y1;
+ second_half->y4 = bez->y4;
+ first_half->y3 = (first_half->y2 + c) * 0.5;
+ second_half->y2 = (second_half->y3 + c) * 0.5;
+ first_half->y4 = second_half->y1 =
+ (first_half->y3 + second_half->y2) * 0.5;
+}
+
+struct polygon * bezier_to_polygon(struct bezier *bez)
+{
+ struct polygon *poly = polygon_create(64);
+ polygon_vertex_append(poly, bez->x1, bez->y1);
+ bezier_add_to_polygon(bez, poly);
+ return poly;
+}
+
+void bezier_add_to_polygon(const struct bezier *bez,
+ struct polygon *poly)
+{
+ struct bezier beziers[32];
+ struct bezier *b;
+
+ beziers[0] = *bez;
+ b = beziers;
+
+ while (b >= beziers) {
+ double y4y1 = b->y4 - b->y1;
+ double x4x1 = b->x4 - b->x1;
+ double l = ABS(x4x1) + ABS(y4y1);
+ double d;
+ if (l > 1.f) {
+ d = ABS((x4x1)*(b->y1 - b->y2) - (y4y1)*(b->x1 - b->x2))
+ + ABS((x4x1)*(b->y1 - b->y3) - (y4y1)*(b->x1 - b->x3));
+ } else {
+ d = ABS(b->x1 - b->x2) + ABS(b->y1 - b->y2) +
+ ABS(b->x1 - b->x3) + ABS(b->y1 - b->y3);
+ l = 1.;
+ }
+ if (d < flatness*l || b == beziers + 31) {
+ /* good enough, we pop it off and add the endpoint */
+ polygon_vertex_append(poly, b->x4, b->y4);
+ --b;
+ } else {
+ /* split, second half of the bezier goes lower into the stack */
+ split(b, b+1, b);
+ ++b;
+ }
+ }
+}
+
+static void add_if_close(struct bezier *bez, VGfloat *length, VGfloat error)
+{
+ struct bezier left, right; /* bez poly splits */
+ VGfloat len = 0.0; /* arc length */
+ VGfloat chord; /* chord length */
+
+ len = len + line_length(bez->x1, bez->y1, bez->x2, bez->y2);
+ len = len + line_length(bez->x2, bez->y2, bez->x3, bez->y3);
+ len = len + line_length(bez->x3, bez->y3, bez->x4, bez->y4);
+
+ chord = line_length(bez->x1, bez->y1, bez->x4, bez->y4);
+
+ if ((len-chord) > error) {
+ split(bez, &left, &right); /* split in two */
+ add_if_close(&left, length, error); /* try left side */
+ add_if_close(&right, length, error); /* try right side */
+ return;
+ }
+
+ *length = *length + len;
+
+ return;
+}
+
+float bezier_length(struct bezier *bez, float error)
+{
+ VGfloat length = 0.f;
+
+ add_if_close(bez, &length, error);
+ return length;
+}
+
+void bezier_init(struct bezier *bez,
+ float x1, float y1,
+ float x2, float y2,
+ float x3, float y3,
+ float x4, float y4)
+{
+ bez->x1 = x1;
+ bez->y1 = y1;
+ bez->x2 = x2;
+ bez->y2 = y2;
+ bez->x3 = x3;
+ bez->y3 = y3;
+ bez->x4 = x4;
+ bez->y4 = y4;
+#if 0
+ debug_printf("bezier in [%f, %f, %f, %f, %f, %f]\n",
+ x1, y1, x2, y2, x3, y3, x4, y4);
+#endif
+}
+
+
+static INLINE void bezier_init2v(struct bezier *bez,
+ float *pt1,
+ float *pt2,
+ float *pt3,
+ float *pt4)
+{
+ bez->x1 = pt1[0];
+ bez->y1 = pt1[1];
+
+ bez->x2 = pt2[0];
+ bez->y2 = pt2[1];
+
+ bez->x3 = pt3[0];
+ bez->y3 = pt3[1];
+
+ bez->x4 = pt4[0];
+ bez->y4 = pt4[1];
+}
+
+
+void bezier_transform(struct bezier *bez,
+ struct matrix *matrix)
+{
+ assert(matrix_is_affine(matrix));
+ matrix_map_point(matrix, bez->x1, bez->y1, &bez->x1, &bez->y1);
+ matrix_map_point(matrix, bez->x2, bez->y2, &bez->x2, &bez->y2);
+ matrix_map_point(matrix, bez->x3, bez->y3, &bez->x3, &bez->y3);
+ matrix_map_point(matrix, bez->x4, bez->y4, &bez->x4, &bez->y4);
+}
+
+static INLINE void bezier_point_at(const struct bezier *bez, float t, float *pt)
+{
+ float a, b, c, d;
+ float m_t;
+ m_t = 1. - t;
+ b = m_t * m_t;
+ c = t * t;
+ d = c * t;
+ a = b * m_t;
+ b *= 3. * t;
+ c *= 3. * m_t;
+ pt[0] = a*bez->x1 + b*bez->x2 + c*bez->x3 + d*bez->x4;
+ pt[1] = a*bez->y1 + b*bez->y2 + c*bez->y3 + d*bez->y4;
+}
+
+static INLINE void bezier_normal_at(const struct bezier *bez, float t, float *norm)
+{
+ float m_t = 1. - t;
+ float a = m_t * m_t;
+ float b = t * m_t;
+ float c = t * t;
+
+ norm[0] = (bez->y2-bez->y1) * a + (bez->y3-bez->y2) * b + (bez->y4-bez->y3) * c;
+ norm[1] = -(bez->x2-bez->x1) * a - (bez->x3-bez->x2) * b - (bez->x4-bez->x3) * c;
+}
+
+enum shift_result {
+ Ok,
+ Discard,
+ Split,
+ Circle
+};
+
+static enum shift_result good_offset(const struct bezier *b1,
+ const struct bezier *b2,
+ float offset, float threshold)
+{
+ const float o2 = offset*offset;
+ const float max_dist_line = threshold*offset*offset;
+ const float max_dist_normal = threshold*offset;
+ const float spacing = 0.25;
+ for (float i = spacing; i < 0.99; i += spacing) {
+ float p1[2],p2[2], d, l;
+ float normal[2];
+ bezier_point_at(b1, i, p1);
+ bezier_point_at(b2, i, p2);
+ d = (p1[0] - p2[0])*(p1[0] - p2[0]) + (p1[1] - p2[1])*(p1[1] - p2[1]);
+ if (ABS(d - o2) > max_dist_line)
+ return Split;
+
+ bezier_normal_at(b1, i, normal);
+ l = ABS(normal[0]) + ABS(normal[1]);
+ if (l != 0.) {
+ d = ABS(normal[0]*(p1[1] - p2[1]) - normal[1]*(p1[0] - p2[0]) ) / l;
+ if (d > max_dist_normal)
+ return Split;
+ }
+ }
+ return Ok;
+}
+
+static INLINE void shift_line_by_normal(float *l, float offset)
+{
+ float norm[4];
+ float tx, ty;
+
+ line_normal(l, norm);
+ line_normalize(norm);
+
+ tx = (norm[2] - norm[0]) * offset;
+ ty = (norm[3] - norm[1]) * offset;
+ l[0] += tx; l[1] += ty;
+ l[2] += tx; l[3] += ty;
+}
+
+static INLINE VGboolean is_bezier_line(float (*points)[2], int count)
+{
+ float dx13 = points[2][0] - points[0][0];
+ float dy13 = points[2][1] - points[0][1];
+
+ float dx12 = points[1][0] - points[0][0];
+ float dy12 = points[1][1] - points[0][1];
+
+ debug_assert(count > 2);
+
+ if (count == 3) {
+ return floatsEqual(dx12 * dy13, dx13 * dy12);
+ } else if (count == 4) {
+ float dx14 = points[3][0] - points[0][0];
+ float dy14 = points[3][1] - points[0][1];
+
+ return (floatsEqual(dx12 * dy13, dx13 * dy12) &&
+ floatsEqual(dx12 * dy14, dx14 * dy12));
+ }
+
+ return VG_FALSE;
+}
+
+static INLINE void compute_pt_normal(float *pt1, float *pt2, float *res)
+{
+ float line[4];
+ float normal[4];
+ line[0] = 0.f; line[1] = 0.f;
+ line[2] = pt2[0] - pt1[0];
+ line[3] = pt2[1] - pt1[1];
+ line_normal(line, normal);
+ line_normalize(normal);
+
+ res[0] = normal[2];
+ res[1] = normal[3];
+}
+
+static enum shift_result shift(const struct bezier *orig,
+ struct bezier *shifted,
+ float offset, float threshold)
+{
+ int map[4];
+ VGboolean p1_p2_equal = (orig->x1 == orig->x2 && orig->y1 == orig->y2);
+ VGboolean p2_p3_equal = (orig->x2 == orig->x3 && orig->y2 == orig->y3);
+ VGboolean p3_p4_equal = (orig->x3 == orig->x4 && orig->y3 == orig->y4);
+
+ float points[4][2];
+ int np = 0;
+ float bounds[4];
+ float points_shifted[4][2];
+ float prev_normal[2];
+
+ points[np][0] = orig->x1;
+ points[np][1] = orig->y1;
+ map[0] = 0;
+ ++np;
+ if (!p1_p2_equal) {
+ points[np][0] = orig->x2;
+ points[np][1] = orig->y2;
+ ++np;
+ }
+ map[1] = np - 1;
+ if (!p2_p3_equal) {
+ points[np][0] = orig->x3;
+ points[np][1] = orig->y3;
+ ++np;
+ }
+ map[2] = np - 1;
+ if (!p3_p4_equal) {
+ points[np][0] = orig->x4;
+ points[np][1] = orig->y4;
+ ++np;
+ }
+ map[3] = np - 1;
+ if (np == 1)
+ return Discard;
+
+ /* We need to specialcase lines of 3 or 4 points due to numerical
+ instability in intersection code below */
+ if (np > 2 && is_bezier_line(points, np)) {
+ float l[4] = { points[0][0], points[0][1],
+ points[np-1][0], points[np-1][1] };
+ float ctrl1[2], ctrl2[2];
+ if (floatsEqual(points[0][0], points[np-1][0]) &&
+ floatsEqual(points[0][1], points[np-1][1]))
+ return Discard;
+
+ shift_line_by_normal(l, offset);
+ line_point_at(l, 0.33, ctrl1);
+ line_point_at(l, 0.66, ctrl2);
+ bezier_init(shifted, l[0], l[1],
+ ctrl1[0], ctrl1[1], ctrl2[0], ctrl2[1],
+ l[2], l[3]);
+ return Ok;
+ }
+
+ bezier_bounds(orig, bounds);
+ if (np == 4 && bounds[2] < .1*offset && bounds[3] < .1*offset) {
+ float l = (orig->x1 - orig->x2)*(orig->x1 - orig->x2) +
+ (orig->y1 - orig->y2)*(orig->y1 - orig->y1) *
+ (orig->x3 - orig->x4)*(orig->x3 - orig->x4) +
+ (orig->y3 - orig->y4)*(orig->y3 - orig->y4);
+ float dot = (orig->x1 - orig->x2)*(orig->x3 - orig->x4) +
+ (orig->y1 - orig->y2)*(orig->y3 - orig->y4);
+ if (dot < 0 && dot*dot < 0.8*l)
+ /* the points are close and reverse dirction. Approximate the whole
+ thing by a semi circle */
+ return Circle;
+ }
+
+ compute_pt_normal(points[0], points[1], prev_normal);
+
+ points_shifted[0][0] = points[0][0] + offset * prev_normal[0];
+ points_shifted[0][1] = points[0][1] + offset * prev_normal[1];
+
+ for (int i = 1; i < np - 1; ++i) {
+ float normal_sum[2], r;
+ float next_normal[2];
+ compute_pt_normal(points[i], points[i + 1], next_normal);
+
+ normal_sum[0] = prev_normal[0] + next_normal[0];
+ normal_sum[1] = prev_normal[1] + next_normal[1];
+
+ r = 1.0 + prev_normal[0] * next_normal[0]
+ + prev_normal[1] * next_normal[1];
+
+ if (floatsEqual(r + 1, 1)) {
+ points_shifted[i][0] = points[i][0] + offset * prev_normal[0];
+ points_shifted[i][1] = points[i][1] + offset * prev_normal[1];
+ } else {
+ float k = offset / r;
+ points_shifted[i][0] = points[i][0] + k * normal_sum[0];
+ points_shifted[i][1] = points[i][1] + k * normal_sum[1];
+ }
+
+ prev_normal[0] = next_normal[0];
+ prev_normal[1] = next_normal[1];
+ }
+
+ points_shifted[np - 1][0] = points[np - 1][0] + offset * prev_normal[0];
+ points_shifted[np - 1][1] = points[np - 1][1] + offset * prev_normal[1];
+
+ bezier_init2v(shifted,
+ points_shifted[map[0]], points_shifted[map[1]],
+ points_shifted[map[2]], points_shifted[map[3]]);
+
+ return good_offset(orig, shifted, offset, threshold);
+}
+
+static VGboolean make_circle(const struct bezier *b, float offset, struct bezier *o)
+{
+ float normals[3][2];
+ float dist;
+ float angles[2];
+ float sign = 1.f;
+ int i;
+ float circle[3][2];
+
+ normals[0][0] = b->y2 - b->y1;
+ normals[0][1] = b->x1 - b->x2;
+ dist = sqrt(normals[0][0]*normals[0][0] + normals[0][1]*normals[0][1]);
+ if (floatsEqual(dist + 1, 1.f))
+ return VG_FALSE;
+ normals[0][0] /= dist;
+ normals[0][1] /= dist;
+
+ normals[2][0] = b->y4 - b->y3;
+ normals[2][1] = b->x3 - b->x4;
+ dist = sqrt(normals[2][0]*normals[2][0] + normals[2][1]*normals[2][1]);
+ if (floatsEqual(dist + 1, 1.f))
+ return VG_FALSE;
+ normals[2][0] /= dist;
+ normals[2][1] /= dist;
+
+ normals[1][0] = b->x1 - b->x2 - b->x3 + b->x4;
+ normals[1][1] = b->y1 - b->y2 - b->y3 + b->y4;
+ dist = -1*sqrt(normals[1][0]*normals[1][0] + normals[1][1]*normals[1][1]);
+ normals[1][0] /= dist;
+ normals[1][1] /= dist;
+
+ for (i = 0; i < 2; ++i) {
+ float cos_a = normals[i][0]*normals[i+1][0] + normals[i][1]*normals[i+1][1];
+ if (cos_a > 1.)
+ cos_a = 1.;
+ if (cos_a < -1.)
+ cos_a = -1;
+ angles[i] = acos(cos_a)/M_PI;
+ }
+
+ if (angles[0] + angles[1] > 1.) {
+ /* more than 180 degrees */
+ normals[1][0] = -normals[1][0];
+ normals[1][1] = -normals[1][1];
+ angles[0] = 1. - angles[0];
+ angles[1] = 1. - angles[1];
+ sign = -1.;
+ }
+
+ circle[0][0] = b->x1 + normals[0][0]*offset;
+ circle[0][1] = b->y1 + normals[0][1]*offset;
+
+ circle[1][0] = 0.5*(b->x1 + b->x4) + normals[1][0]*offset;
+ circle[1][1] = 0.5*(b->y1 + b->y4) + normals[1][1]*offset;
+
+ circle[2][0] = b->x4 + normals[2][0]*offset;
+ circle[2][1] = b->y4 + normals[2][1]*offset;
+
+ for (i = 0; i < 2; ++i) {
+ float kappa = 2.*KAPPA * sign * offset * angles[i];
+
+ o->x1 = circle[i][0];
+ o->y1 = circle[i][1];
+ o->x2 = circle[i][0] - normals[i][1]*kappa;
+ o->y2 = circle[i][1] + normals[i][0]*kappa;
+ o->x3 = circle[i+1][0] + normals[i+1][1]*kappa;
+ o->y3 = circle[i+1][1] - normals[i+1][0]*kappa;
+ o->x4 = circle[i+1][0];
+ o->y4 = circle[i+1][1];
+
+ ++o;
+ }
+ return VG_TRUE;
+}
+
+int bezier_translate_by_normal(struct bezier *bez,
+ struct bezier *curves,
+ int max_curves,
+ float normal_len,
+ float threshold)
+{
+ struct bezier beziers[10];
+ struct bezier *b, *o;
+
+ /* fixme: this should really be floatsEqual */
+ if (bez->x1 == bez->x2 && bez->x1 == bez->x3 && bez->x1 == bez->x4 &&
+ bez->y1 == bez->y2 && bez->y1 == bez->y3 && bez->y1 == bez->y4)
+ return 0;
+
+ --max_curves;
+redo:
+ beziers[0] = *bez;
+ b = beziers;
+ o = curves;
+
+ while (b >= beziers) {
+ int stack_segments = b - beziers + 1;
+ enum shift_result res;
+ if ((stack_segments == 10) || (o - curves == max_curves - stack_segments)) {
+ threshold *= 1.5;
+ if (threshold > 2.)
+ goto give_up;
+ goto redo;
+ }
+ res = shift(b, o, normal_len, threshold);
+ if (res == Discard) {
+ --b;
+ } else if (res == Ok) {
+ ++o;
+ --b;
+ continue;
+ } else if (res == Circle && max_curves - (o - curves) >= 2) {
+ /* add semi circle */
+ if (make_circle(b, normal_len, o))
+ o += 2;
+ --b;
+ } else {
+ split(b, b+1, b);
+ ++b;
+ }
+ }
+
+give_up:
+ while (b >= beziers) {
+ enum shift_result res = shift(b, o, normal_len, threshold);
+
+ /* if res isn't Ok or Split then *o is undefined */
+ if (res == Ok || res == Split)
+ ++o;
+
+ --b;
+ }
+
+ debug_assert(o - curves <= max_curves);
+ return o - curves;
+}
+
+void bezier_bounds(const struct bezier *bez,
+ float *bounds/*x/y/width/height*/)
+{
+ float xmin = bez->x1;
+ float xmax = bez->x1;
+ float ymin = bez->y1;
+ float ymax = bez->y1;
+
+ if (bez->x2 < xmin)
+ xmin = bez->x2;
+ else if (bez->x2 > xmax)
+ xmax = bez->x2;
+ if (bez->x3 < xmin)
+ xmin = bez->x3;
+ else if (bez->x3 > xmax)
+ xmax = bez->x3;
+ if (bez->x4 < xmin)
+ xmin = bez->x4;
+ else if (bez->x4 > xmax)
+ xmax = bez->x4;
+
+ if (bez->y2 < ymin)
+ ymin = bez->y2;
+ else if (bez->y2 > ymax)
+ ymax = bez->y2;
+ if (bez->y3 < ymin)
+ ymin = bez->y3;
+ else if (bez->y3 > ymax)
+ ymax = bez->y3;
+ if (bez->y4 < ymin)
+ ymin = bez->y4;
+ else if (bez->y4 > ymax)
+ ymax = bez->y4;
+
+ bounds[0] = xmin; /* x */
+ bounds[1] = ymin; /* y */
+ bounds[2] = xmax - xmin; /* width */
+ bounds[3] = ymax - ymin; /* height */
+}
+
+void bezier_start_tangent(const struct bezier *bez,
+ float *tangent)
+{
+ tangent[0] = bez->x1;
+ tangent[1] = bez->y1;
+ tangent[2] = bez->x2;
+ tangent[3] = bez->y2;
+
+ if (null_line(tangent)) {
+ tangent[0] = bez->x1;
+ tangent[1] = bez->y1;
+ tangent[2] = bez->x3;
+ tangent[3] = bez->y3;
+ }
+ if (null_line(tangent)) {
+ tangent[0] = bez->x1;
+ tangent[1] = bez->y1;
+ tangent[2] = bez->x4;
+ tangent[3] = bez->y4;
+ }
+}
+
+
+static INLINE VGfloat bezier_t_at_length(struct bezier *bez,
+ VGfloat at_length,
+ VGfloat error)
+{
+ VGfloat len = bezier_length(bez, error);
+ VGfloat t = 1.0;
+ VGfloat last_bigger = 1.;
+
+ if (at_length > len || floatsEqual(at_length, len))
+ return t;
+
+ if (floatIsZero(at_length))
+ return 0.f;
+
+ t *= 0.5;
+ while (1) {
+ struct bezier right = *bez;
+ struct bezier left;
+ VGfloat tmp_len;
+ split_left(&right, t, &left);
+ tmp_len = bezier_length(&left, error);
+ if (ABS(tmp_len - at_length) < error)
+ break;
+
+ if (tmp_len < at_length) {
+ t += (last_bigger - t)*.5;
+ } else {
+ last_bigger = t;
+ t -= t*.5;
+ }
+ }
+ return t;
+}
+
+void bezier_point_at_length(struct bezier *bez,
+ float length,
+ float *point,
+ float *normal)
+{
+ /* ~0.000001 seems to be required to pass G2080x tests */
+ VGfloat t = bezier_t_at_length(bez, length, 0.000001);
+ bezier_point_at(bez, t, point);
+ bezier_normal_at(bez, t, normal);
+ vector_unit(normal);
+}
+
+void bezier_point_at_t(struct bezier *bez, float t,
+ float *point, float *normal)
+{
+ bezier_point_at(bez, t, point);
+ bezier_normal_at(bez, t, normal);
+ vector_unit(normal);
+}
+
+void bezier_exact_bounds(const struct bezier *bez,
+ float *bounds/*x/y/width/height*/)
+{
+ struct polygon *poly = polygon_create(64);
+ polygon_vertex_append(poly, bez->x1, bez->y1);
+ bezier_add_to_polygon(bez, poly);
+ polygon_bounding_rect(poly, bounds);
+ polygon_destroy(poly);
+}
+
diff --git a/src/gallium/state_trackers/vega/bezier.h b/src/gallium/state_trackers/vega/bezier.h
new file mode 100644
index 00000000000..e06666051ca
--- /dev/null
+++ b/src/gallium/state_trackers/vega/bezier.h
@@ -0,0 +1,81 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef BEZIER_H
+#define BEZIER_H
+
+struct polygon;
+struct matrix;
+
+struct bezier {
+ float x1, y1;
+ float x2, y2;
+ float x3, y3;
+ float x4, y4;
+};
+
+
+#define BEZIER_DEFAULT_ERROR 0.01
+
+/* kappa as being l of a circle with r = 1, we can emulate any
+ * circle of radius r by using the formula
+ * l = r . kappa
+ * More at:
+ * http://www.whizkidtech.redprince.net/bezier/circle/ */
+#define KAPPA 0.5522847498
+
+void bezier_init(struct bezier *bez,
+ float x1, float y1,
+ float x2, float y2,
+ float x3, float y3,
+ float x4, float y4);
+
+struct polygon *bezier_to_polygon(struct bezier *bez);
+void bezier_add_to_polygon(const struct bezier *bez,
+ struct polygon *poly);
+float bezier_length(struct bezier *bez, float error);
+void bezier_transform(struct bezier *bez,
+ struct matrix *mat);
+
+int bezier_translate_by_normal(struct bezier *b,
+ struct bezier *curves,
+ int max_curves,
+ float normal_len,
+ float threshold);
+void bezier_bounds(const struct bezier *bez,
+ float *bounds/*x/y/width/height*/);
+void bezier_exact_bounds(const struct bezier *bez,
+ float *bounds/*x/y/width/height*/);
+
+void bezier_start_tangent(const struct bezier *bez,
+ float *tangent);
+
+void bezier_point_at_length(struct bezier *bez, float length,
+ float *point, float *normal);
+void bezier_point_at_t(struct bezier *bez, float t,
+ float *point, float *normal);
+
+#endif
diff --git a/src/gallium/state_trackers/vega/image.c b/src/gallium/state_trackers/vega/image.c
new file mode 100644
index 00000000000..9a722980d52
--- /dev/null
+++ b/src/gallium/state_trackers/vega/image.c
@@ -0,0 +1,654 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "image.h"
+
+#include "vg_translate.h"
+#include "vg_context.h"
+#include "matrix.h"
+#include "renderer.h"
+#include "util_array.h"
+#include "api_consts.h"
+#include "shaders_cache.h"
+#include "shader.h"
+
+#include "pipe/p_context.h"
+#include "pipe/p_screen.h"
+#include "pipe/p_inlines.h"
+#include "util/u_blit.h"
+#include "util/u_tile.h"
+#include "util/u_memory.h"
+#include "util/u_math.h"
+
+static enum pipe_format vg_format_to_pipe(VGImageFormat format)
+{
+ switch(format) {
+ case VG_sRGB_565:
+ return PIPE_FORMAT_R5G6B5_UNORM;
+ case VG_sRGBA_5551:
+ return PIPE_FORMAT_A1R5G5B5_UNORM;
+ case VG_sRGBA_4444:
+ return PIPE_FORMAT_A4R4G4B4_UNORM;
+ case VG_sL_8:
+ case VG_lL_8:
+ return PIPE_FORMAT_L8_UNORM;
+ case VG_BW_1:
+ return PIPE_FORMAT_A8R8G8B8_UNORM;
+ case VG_A_8:
+ return PIPE_FORMAT_A8_UNORM;
+#ifdef OPENVG_VERSION_1_1
+ case VG_A_1:
+ case VG_A_4:
+ return PIPE_FORMAT_A8_UNORM;
+#endif
+ default:
+ return PIPE_FORMAT_A8R8G8B8_UNORM;
+ }
+}
+
+static INLINE void vg_sync_size(VGfloat *src_loc, VGfloat *dst_loc)
+{
+ src_loc[2] = MIN2(src_loc[2], dst_loc[2]);
+ src_loc[3] = MIN2(src_loc[3], dst_loc[3]);
+ dst_loc[2] = src_loc[2];
+ dst_loc[3] = src_loc[3];
+}
+
+
+static void vg_copy_texture(struct vg_context *ctx,
+ struct pipe_texture *dst, VGint dx, VGint dy,
+ struct pipe_texture *src, VGint sx, VGint sy,
+ VGint width, VGint height)
+{
+ VGfloat dst_loc[4], src_loc[4];
+ VGfloat dst_bounds[4], src_bounds[4];
+ VGfloat src_shift[4], dst_shift[4], shift[4];
+
+ dst_loc[0] = dx;
+ dst_loc[1] = dy;
+ dst_loc[2] = width;
+ dst_loc[3] = height;
+ dst_bounds[0] = 0.f;
+ dst_bounds[1] = 0.f;
+ dst_bounds[2] = dst->width[0];
+ dst_bounds[3] = dst->height[0];
+
+ src_loc[0] = sx;
+ src_loc[1] = sy;
+ src_loc[2] = width;
+ src_loc[3] = height;
+ src_bounds[0] = 0.f;
+ src_bounds[1] = 0.f;
+ src_bounds[2] = src->width[0];
+ src_bounds[3] = src->height[0];
+
+ vg_bound_rect(src_loc, src_bounds, src_shift);
+ vg_bound_rect(dst_loc, dst_bounds, dst_shift);
+ shift[0] = src_shift[0] - dst_shift[0];
+ shift[1] = src_shift[1] - dst_shift[1];
+
+ if (shift[0] < 0)
+ vg_shift_rectx(src_loc, src_bounds, -shift[0]);
+ else
+ vg_shift_rectx(dst_loc, dst_bounds, shift[0]);
+
+ if (shift[1] < 0)
+ vg_shift_recty(src_loc, src_bounds, -shift[1]);
+ else
+ vg_shift_recty(dst_loc, dst_bounds, shift[1]);
+
+ vg_sync_size(src_loc, dst_loc);
+
+ if (src_loc[2] >= 0 && src_loc[3] >= 0 &&
+ dst_loc[2] >= 0 && dst_loc[3] >= 0) {
+ renderer_copy_texture(ctx->renderer,
+ src,
+ src_loc[0],
+ src_loc[1] + src_loc[3],
+ src_loc[0] + src_loc[2],
+ src_loc[1],
+ dst,
+ dst_loc[0],
+ dst_loc[1] + dst_loc[3],
+ dst_loc[0] + dst_loc[2],
+ dst_loc[1]);
+ }
+
+}
+
+void vg_copy_surface(struct vg_context *ctx,
+ struct pipe_surface *dst, VGint dx, VGint dy,
+ struct pipe_surface *src, VGint sx, VGint sy,
+ VGint width, VGint height)
+{
+ VGfloat dst_loc[4], src_loc[4];
+ VGfloat dst_bounds[4], src_bounds[4];
+ VGfloat src_shift[4], dst_shift[4], shift[4];
+
+ dst_loc[0] = dx;
+ dst_loc[1] = dy;
+ dst_loc[2] = width;
+ dst_loc[3] = height;
+ dst_bounds[0] = 0.f;
+ dst_bounds[1] = 0.f;
+ dst_bounds[2] = dst->width;
+ dst_bounds[3] = dst->height;
+
+ src_loc[0] = sx;
+ src_loc[1] = sy;
+ src_loc[2] = width;
+ src_loc[3] = height;
+ src_bounds[0] = 0.f;
+ src_bounds[1] = 0.f;
+ src_bounds[2] = src->width;
+ src_bounds[3] = src->height;
+
+ vg_bound_rect(src_loc, src_bounds, src_shift);
+ vg_bound_rect(dst_loc, dst_bounds, dst_shift);
+ shift[0] = src_shift[0] - dst_shift[0];
+ shift[1] = src_shift[1] - dst_shift[1];
+
+ if (shift[0] < 0)
+ vg_shift_rectx(src_loc, src_bounds, -shift[0]);
+ else
+ vg_shift_rectx(dst_loc, dst_bounds, shift[0]);
+
+ if (shift[1] < 0)
+ vg_shift_recty(src_loc, src_bounds, -shift[1]);
+ else
+ vg_shift_recty(dst_loc, dst_bounds, shift[1]);
+
+ vg_sync_size(src_loc, dst_loc);
+
+ if (src_loc[2] > 0 && src_loc[3] > 0 &&
+ dst_loc[2] > 0 && dst_loc[3] > 0) {
+ if (src == dst)
+ renderer_copy_surface(ctx->renderer,
+ src,
+ src_loc[0],
+ src->height - (src_loc[1] + src_loc[3]),
+ src_loc[0] + src_loc[2],
+ src->height - src_loc[1],
+ dst,
+ dst_loc[0],
+ dst->height - (dst_loc[1] + dst_loc[3]),
+ dst_loc[0] + dst_loc[2],
+ dst->height - dst_loc[1],
+ 0, 0);
+ else
+ renderer_copy_surface(ctx->renderer,
+ src,
+ src_loc[0],
+ src->height - src_loc[1],
+ src_loc[0] + src_loc[2],
+ src->height - (src_loc[1] + src_loc[3]),
+ dst,
+ dst_loc[0],
+ dst->height - (dst_loc[1] + dst_loc[3]),
+ dst_loc[0] + dst_loc[2],
+ dst->height - dst_loc[1],
+ 0, 0);
+ }
+
+}
+
+static struct pipe_texture *image_texture(struct vg_image *img)
+{
+ struct pipe_texture *tex = img->texture;
+ return tex;
+}
+
+
+static void image_cleari(struct vg_image *img, VGint clear_colori,
+ VGint x, VGint y, VGint width, VGint height)
+{
+ VGint *clearbuf;
+ VGint i;
+ VGfloat dwidth, dheight;
+
+ clearbuf = malloc(sizeof(VGint)*width*height);
+ for (i = 0; i < width*height; ++i)
+ clearbuf[i] = clear_colori;
+
+ dwidth = MIN2(width, img->width);
+ dheight = MIN2(height, img->height);
+
+ image_sub_data(img, clearbuf, width * sizeof(VGint),
+ VG_sRGBA_8888,
+ x, y, dwidth, dheight);
+ free(clearbuf);
+}
+
+struct vg_image * image_create(VGImageFormat format,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *image = CALLOC_STRUCT(vg_image);
+ enum pipe_format pformat = vg_format_to_pipe(format);
+ struct pipe_texture pt, *newtex;
+ struct pipe_screen *screen = ctx->pipe->screen;
+
+ vg_init_object(&image->base, ctx, VG_OBJECT_IMAGE);
+
+ image->format = format;
+ image->width = width;
+ image->height = height;
+
+ image->sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ image->sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ image->sampler.wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ image->sampler.min_img_filter = PIPE_TEX_MIPFILTER_NEAREST;
+ image->sampler.mag_img_filter = PIPE_TEX_MIPFILTER_NEAREST;
+ image->sampler.normalized_coords = 1;
+
+ assert(screen->is_format_supported(screen, pformat, PIPE_TEXTURE_2D,
+ PIPE_TEXTURE_USAGE_SAMPLER, 0));
+
+ memset(&pt, 0, sizeof(pt));
+ pt.target = PIPE_TEXTURE_2D;
+ pt.format = pformat;
+ pf_get_block(pformat, &pt.block);
+ pt.last_level = 0;
+ pt.width[0] = width;
+ pt.height[0] = height;
+ pt.depth[0] = 1;
+ pt.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER;
+
+ newtex = screen->texture_create(screen, &pt);
+
+ debug_assert(newtex);
+
+ image->texture = newtex;
+
+ vg_context_add_object(ctx, VG_OBJECT_IMAGE, image);
+
+ image_cleari(image, 0, 0, 0, image->width, image->height);
+ return image;
+}
+
+void image_destroy(struct vg_image *img)
+{
+ struct vg_context *ctx = vg_current_context();
+ vg_context_remove_object(ctx, VG_OBJECT_IMAGE, img);
+
+
+ if (img->parent) {
+ /* remove img from the parent child array */
+ int idx;
+ struct vg_image **array =
+ (struct vg_image **)img->parent->children_array->data;
+
+ for (idx = 0; idx < img->parent->children_array->num_elements; ++idx) {
+ struct vg_image *child = array[idx];
+ if (child == img) {
+ break;
+ }
+ }
+ debug_assert(idx < img->parent->children_array->num_elements);
+ array_remove_element(img->parent->children_array, idx);
+ }
+
+ if (img->children_array && img->children_array->num_elements) {
+ /* reparent the children */
+ VGint i;
+ struct vg_image *parent = img->parent;
+ struct vg_image **children =
+ (struct vg_image **)img->children_array->data;
+ if (!parent) {
+ VGint min_x = children[0]->x;
+ parent = children[0];
+
+ for (i = 1; i < img->children_array->num_elements; ++i) {
+ struct vg_image *child = children[i];
+ if (child->x < min_x) {
+ parent = child;
+ }
+ }
+ }
+
+ for (i = 0; i < img->children_array->num_elements; ++i) {
+ struct vg_image *child = children[i];
+ if (child != parent) {
+ child->parent = parent;
+ if (!parent->children_array) {
+ parent->children_array = array_create(
+ sizeof(struct vg_image*));
+ }
+ array_append_data(parent->children_array,
+ &child, 1);
+ } else
+ child->parent = NULL;
+ }
+ array_destroy(img->children_array);
+ }
+
+ pipe_texture_reference(&img->texture, NULL);
+ free(img);
+}
+
+void image_clear(struct vg_image *img,
+ VGint x, VGint y, VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ VGfloat *clear_colorf = ctx->state.vg.clear_color;
+ VGubyte r, g, b ,a;
+ VGint clear_colori;
+ /* FIXME: this is very nasty */
+ r = float_to_ubyte(clear_colorf[0]);
+ g = float_to_ubyte(clear_colorf[1]);
+ b = float_to_ubyte(clear_colorf[2]);
+ a = float_to_ubyte(clear_colorf[3]);
+ clear_colori = r << 24 | g << 16 | b << 8 | a;
+ image_cleari(img, clear_colori, x, y, width, height);
+}
+
+void image_sub_data(struct vg_image *image,
+ const void * data,
+ VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint x, VGint y,
+ VGint width, VGint height)
+{
+ const VGint yStep = 1;
+ VGubyte *src = (VGubyte *)data;
+ VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4];
+ VGfloat *df = (VGfloat*)temp;
+ VGint i;
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_screen *screen = ctx->pipe->screen;
+ struct pipe_texture *texture = image_texture(image);
+ VGint xoffset = 0, yoffset = 0;
+
+ if (x < 0) {
+ xoffset -= x;
+ width += x;
+ x = 0;
+ }
+ if (y < 0) {
+ yoffset -= y;
+ height += y;
+ y = 0;
+ }
+
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (x > image->width || y > image->width) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+
+ if (x + width > image->width) {
+ width = image->width - x;
+ }
+
+ if (y + height > image->height) {
+ height = image->height - y;
+ }
+
+ { /* upload color_data */
+ struct pipe_transfer *transfer = screen->get_tex_transfer(
+ screen, texture, 0, 0, 0,
+ PIPE_TRANSFER_WRITE, 0, 0, texture->width[0], texture->height[0]);
+ src += (dataStride * yoffset);
+ for (i = 0; i < height; i++) {
+ _vega_unpack_float_span_rgba(ctx, width, xoffset, src, dataFormat, temp);
+ pipe_put_tile_rgba(transfer, x+image->x, y+image->y, width, 1, df);
+ y += yStep;
+ src += dataStride;
+ }
+ screen->tex_transfer_destroy(transfer);
+ }
+}
+
+void image_get_sub_data(struct vg_image * image,
+ void * data,
+ VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint sx, VGint sy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_context *pipe = ctx->pipe;
+ struct pipe_screen *screen = pipe->screen;
+ VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4];
+ VGfloat *df = (VGfloat*)temp;
+ VGint y = 0, yStep = 1;
+ VGint i;
+ VGubyte *dst = (VGubyte *)data;
+
+ {
+ struct pipe_transfer *transfer =
+ screen->get_tex_transfer(screen,
+ image->texture, 0, 0, 0,
+ PIPE_TRANSFER_READ,
+ 0, 0,
+ image->x + image->width,
+ image->y + image->height);
+ /* Do a row at a time to flip image data vertically */
+ for (i = 0; i < height; i++) {
+#if 0
+ debug_printf("%d-%d == %d\n", sy, height, y);
+#endif
+ pipe_get_tile_rgba(transfer, sx+image->x, y, width, 1, df);
+ y += yStep;
+ _vega_pack_rgba_span_float(ctx, width, temp, dataFormat, dst);
+ dst += dataStride;
+ }
+
+ screen->tex_transfer_destroy(transfer);
+ }
+}
+
+struct vg_image * image_child_image(struct vg_image *parent,
+ VGint x, VGint y,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_image *image = CALLOC_STRUCT(vg_image);
+
+ vg_init_object(&image->base, ctx, VG_OBJECT_IMAGE);
+
+ image->x = parent->x + x;
+ image->y = parent->y + y;
+ image->width = width;
+ image->height = height;
+ image->parent = parent;
+ image->texture = 0;
+ pipe_texture_reference(&image->texture,
+ parent->texture);
+
+ image->sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ image->sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ image->sampler.wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ image->sampler.min_img_filter = PIPE_TEX_MIPFILTER_NEAREST;
+ image->sampler.mag_img_filter = PIPE_TEX_MIPFILTER_NEAREST;
+ image->sampler.normalized_coords = 1;
+
+ if (!parent->children_array)
+ parent->children_array = array_create(
+ sizeof(struct vg_image*));
+
+ array_append_data(parent->children_array,
+ &image, 1);
+
+ vg_context_add_object(ctx, VG_OBJECT_IMAGE, image);
+
+ return image;
+}
+
+void image_copy(struct vg_image *dst, VGint dx, VGint dy,
+ struct vg_image *src, VGint sx, VGint sy,
+ VGint width, VGint height,
+ VGboolean dither)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (width <= 0 || height <= 0) {
+ vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR);
+ return;
+ }
+ /* make sure rendering has completed */
+ ctx->pipe->flush(ctx->pipe, PIPE_FLUSH_RENDER_CACHE, NULL);
+ vg_copy_texture(ctx, dst->texture, dst->x + dx, dst->y + dy,
+ src->texture, src->x + sx, src->y + sy, width, height);
+}
+
+void image_draw(struct vg_image *img)
+{
+ struct vg_context *ctx = vg_current_context();
+ VGfloat x1, y1;
+ VGfloat x2, y2;
+ VGfloat x3, y3;
+ VGfloat x4, y4;
+ struct matrix *matrix;
+
+ x1 = 0;
+ y1 = 0;
+ x2 = img->width;
+ y2 = 0;
+ x3 = img->width;
+ y3 = img->height;
+ x4 = 0;
+ y4 = img->height;
+
+ matrix = &ctx->state.vg.image_user_to_surface_matrix;
+
+ matrix_map_point(matrix, x1, y1, &x1, &y1);
+ matrix_map_point(matrix, x2, y2, &x2, &y2);
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ matrix_map_point(matrix, x4, y4, &x4, &y4);
+
+ shader_set_drawing_image(ctx->shader, VG_TRUE);
+ shader_set_paint(ctx->shader, ctx->state.vg.fill_paint);
+ shader_set_image(ctx->shader, img);
+ shader_bind(ctx->shader);
+
+ renderer_texture_quad(ctx->renderer, image_texture(img),
+ img->x, img->y, img->x + img->width, img->y + img->height,
+ x1, y1, x2, y2, x3, y3, x4, y4);
+}
+
+void image_set_pixels(VGint dx, VGint dy,
+ struct vg_image *src, VGint sx, VGint sy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_context *pipe = ctx->pipe;
+ struct pipe_screen *screen = pipe->screen;
+ struct pipe_surface *surf;
+ struct st_renderbuffer *strb = ctx->draw_buffer->strb;
+
+ /* make sure rendering has completed */
+ pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL);
+
+ surf = screen->get_tex_surface(screen, image_texture(src), 0, 0, 0,
+ PIPE_BUFFER_USAGE_GPU_READ);
+
+ vg_copy_surface(ctx, strb->surface, dx, dy,
+ surf, sx+src->x, sy+src->y, width, height);
+
+ screen->tex_surface_destroy(surf);
+}
+
+void image_get_pixels(struct vg_image *dst, VGint dx, VGint dy,
+ VGint sx, VGint sy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_context *pipe = ctx->pipe;
+ struct pipe_screen *screen = pipe->screen;
+ struct pipe_surface *surf;
+ struct st_renderbuffer *strb = ctx->draw_buffer->strb;
+
+ /* flip the y coordinates */
+ /*dy = dst->height - dy - height;*/
+
+ /* make sure rendering has completed */
+ pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL);
+
+ surf = screen->get_tex_surface(screen, image_texture(dst), 0, 0, 0,
+ PIPE_BUFFER_USAGE_GPU_WRITE |
+ PIPE_BUFFER_USAGE_GPU_READ);
+ vg_copy_surface(ctx, surf, dst->x + dx, dst->y + dy,
+ strb->surface, sx, sy, width, height);
+
+ pipe_surface_reference(&surf, NULL);
+}
+
+
+VGboolean vg_image_overlaps(struct vg_image *dst,
+ struct vg_image *src)
+{
+ if (dst == src || dst->parent == src ||
+ dst == src->parent)
+ return VG_TRUE;
+ if (dst->parent && dst->parent == src->parent) {
+ VGfloat left1 = dst->x;
+ VGfloat left2 = src->x;
+ VGfloat right1 = dst->x + dst->width;
+ VGfloat right2 = src->x + src->width;
+ VGfloat bottom1 = dst->y;
+ VGfloat bottom2 = src->y;
+ VGfloat top1 = dst->y + dst->height;
+ VGfloat top2 = src->y + src->height;
+
+ return !(left2 > right1 || right2 < left1 ||
+ top2 > bottom1 || bottom2 < top1);
+ }
+ return VG_FALSE;
+}
+
+VGint image_bind_samplers(struct vg_image *img, struct pipe_sampler_state **samplers,
+ struct pipe_texture **textures)
+{
+ img->sampler.min_img_filter = image_sampler_filter(img->base.ctx);
+ img->sampler.mag_img_filter = image_sampler_filter(img->base.ctx);
+ samplers[3] = &img->sampler;
+ textures[3] = img->texture;
+ return 1;
+}
+
+VGint image_sampler_filter(struct vg_context *ctx)
+{
+ switch(ctx->state.vg.image_quality) {
+ case VG_IMAGE_QUALITY_NONANTIALIASED:
+ return PIPE_TEX_FILTER_NEAREST;
+ break;
+ case VG_IMAGE_QUALITY_FASTER:
+ return PIPE_TEX_FILTER_NEAREST;
+ break;
+ case VG_IMAGE_QUALITY_BETTER:
+ /*return PIPE_TEX_FILTER_ANISO;*/
+ return PIPE_TEX_FILTER_LINEAR;
+ break;
+ default:
+ debug_printf("Unknown image quality");
+ }
+ return PIPE_TEX_FILTER_NEAREST;
+}
diff --git a/src/gallium/state_trackers/vega/image.h b/src/gallium/state_trackers/vega/image.h
new file mode 100644
index 00000000000..78e17cffa64
--- /dev/null
+++ b/src/gallium/state_trackers/vega/image.h
@@ -0,0 +1,104 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef IMAGES_H
+#define IMAGES_H
+
+#include "vg_context.h"
+#include "pipe/p_state.h"
+
+struct pipe_texture;
+struct array;
+struct vg_context;
+struct pipe_surface;
+
+struct vg_image {
+ struct vg_object base;
+ VGImageFormat format;
+ VGint x, y;
+ VGint width, height;
+
+ struct vg_image *parent;
+
+ struct pipe_texture *texture;
+ struct pipe_sampler_state sampler;
+
+ struct array *children_array;
+};
+
+struct vg_image *image_create(VGImageFormat format,
+ VGint width, VGint height);
+void image_destroy(struct vg_image *img);
+
+void image_clear(struct vg_image *img,
+ VGint x, VGint y, VGint width, VGint height);
+
+void image_sub_data(struct vg_image *image,
+ const void * data,
+ VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint x, VGint y,
+ VGint width, VGint height);
+
+void image_get_sub_data(struct vg_image * image,
+ void * data,
+ VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint x, VGint y,
+ VGint width, VGint height);
+
+struct vg_image *image_child_image(struct vg_image *parent,
+ VGint x, VGint y,
+ VGint width, VGint height);
+
+void image_copy(struct vg_image *dst, VGint dx, VGint dy,
+ struct vg_image *src, VGint sx, VGint sy,
+ VGint width, VGint height,
+ VGboolean dither);
+
+void image_draw(struct vg_image *img);
+
+void image_set_pixels(VGint dx, VGint dy,
+ struct vg_image *src, VGint sx, VGint sy,
+ VGint width, VGint height);
+void image_get_pixels(struct vg_image *dst, VGint dx, VGint dy,
+ VGint sx, VGint sy,
+ VGint width, VGint height);
+
+VGint image_bind_samplers(struct vg_image *dst, struct pipe_sampler_state **samplers,
+ struct pipe_texture **textures);
+
+VGboolean vg_image_overlaps(struct vg_image *dst,
+ struct vg_image *src);
+
+VGint image_sampler_filter(struct vg_context *ctx);
+
+void vg_copy_surface(struct vg_context *ctx,
+ struct pipe_surface *dst, VGint dx, VGint dy,
+ struct pipe_surface *src, VGint sx, VGint sy,
+ VGint width, VGint height);
+
+#endif
diff --git a/src/gallium/state_trackers/vega/mask.c b/src/gallium/state_trackers/vega/mask.c
new file mode 100644
index 00000000000..24650a37d50
--- /dev/null
+++ b/src/gallium/state_trackers/vega/mask.c
@@ -0,0 +1,690 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "mask.h"
+
+#include "path.h"
+#include "image.h"
+#include "shaders_cache.h"
+#include "renderer.h"
+#include "asm_util.h"
+#include "st_inlines.h"
+
+#include "pipe/p_context.h"
+#include "pipe/p_screen.h"
+#include "pipe/p_inlines.h"
+#include "util/u_memory.h"
+
+struct vg_mask_layer {
+ struct vg_object base;
+
+ VGint width;
+ VGint height;
+
+ struct pipe_texture *texture;
+};
+
+static INLINE struct pipe_surface *
+alpha_mask_surface(struct vg_context *ctx, int usage)
+{
+ struct pipe_screen *screen = ctx->pipe->screen;
+ struct st_framebuffer *stfb = ctx->draw_buffer;
+ return screen->get_tex_surface(screen,
+ stfb->alpha_mask,
+ 0, 0, 0,
+ usage);
+}
+
+static INLINE VGboolean
+intersect_rectangles(VGint dwidth, VGint dheight,
+ VGint swidth, VGint sheight,
+ VGint tx, VGint ty,
+ VGint twidth, VGint theight,
+ VGint *offsets,
+ VGint *location)
+{
+ if (tx + twidth <= 0 || tx >= dwidth)
+ return VG_FALSE;
+ if (ty + theight <= 0 || ty >= dheight)
+ return VG_FALSE;
+
+ offsets[0] = 0;
+ offsets[1] = 0;
+ location[0] = tx;
+ location[1] = ty;
+
+ if (tx < 0) {
+ offsets[0] -= tx;
+ location[0] = 0;
+
+ location[2] = MIN2(tx + swidth, MIN2(dwidth, tx + twidth));
+ offsets[2] = location[2];
+ } else {
+ offsets[2] = MIN2(twidth, MIN2(dwidth - tx, swidth ));
+ location[2] = offsets[2];
+ }
+
+ if (ty < 0) {
+ offsets[1] -= ty;
+ location[1] = 0;
+
+ location[3] = MIN2(ty + sheight, MIN2(dheight, ty + theight));
+ offsets[3] = location[3];
+ } else {
+ offsets[3] = MIN2(theight, MIN2(dheight - ty, sheight));
+ location[3] = offsets[3];
+ }
+
+ return VG_TRUE;
+}
+
+#if DEBUG_MASKS
+static void read_alpha_mask(void * data, VGint dataStride,
+ VGImageFormat dataFormat,
+ VGint sx, VGint sy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_context *pipe = ctx->pipe;
+ struct pipe_screen *screen = pipe->screen;
+
+ struct st_framebuffer *stfb = ctx->draw_buffer;
+ struct st_renderbuffer *strb = stfb->alpha_mask;
+ struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb;
+
+ VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4];
+ VGfloat *df = (VGfloat*)temp;
+ VGint y = (fb->height - sy) - 1, yStep = -1;
+ VGint i;
+ VGubyte *dst = (VGubyte *)data;
+ VGint xoffset = 0, yoffset = 0;
+
+ /* make sure rendering has completed */
+ pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL);
+ if (sx < 0) {
+ xoffset = -sx;
+ xoffset *= _vega_size_for_format(dataFormat);
+ width += sx;
+ sx = 0;
+ }
+ if (sy < 0) {
+ yoffset = -sy;
+ height += sy;
+ sy = 0;
+ y = (fb->height - sy) - 1;
+ yoffset *= dataStride;
+ }
+
+ {
+ struct pipe_surface *surf;
+
+ surf = screen->get_tex_surface(screen, strb->texture, 0, 0, 0,
+ PIPE_BUFFER_USAGE_CPU_READ);
+
+ /* Do a row at a time to flip image data vertically */
+ for (i = 0; i < height; i++) {
+#if 0
+ debug_printf("%d-%d == %d\n", sy, height, y);
+#endif
+ pipe_get_tile_rgba(surf, sx, y, width, 1, df);
+ y += yStep;
+ _vega_pack_rgba_span_float(ctx, width, temp, dataFormat,
+ dst + yoffset + xoffset);
+ dst += dataStride;
+ }
+
+ pipe_surface_reference(&surf, NULL);
+ }
+}
+
+void save_alpha_to_file(const char *filename)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb;
+ VGint *data;
+ int i, j;
+
+ data = malloc(sizeof(int) * fb->width * fb->height);
+ read_alpha_mask(data, fb->width * sizeof(int),
+ VG_sRGBA_8888,
+ 0, 0, fb->width, fb->height);
+ fprintf(stderr, "/*---------- start */\n");
+ fprintf(stderr, "const int image_width = %d;\n",
+ fb->width);
+ fprintf(stderr, "const int image_height = %d;\n",
+ fb->height);
+ fprintf(stderr, "const int image_data = {\n");
+ for (i = 0; i < fb->height; ++i) {
+ for (j = 0; j < fb->width; ++j) {
+ int rgba = data[i * fb->height + j];
+ int argb = 0;
+ argb = (rgba >> 8);
+ argb |= ((rgba & 0xff) << 24);
+ fprintf(stderr, "0x%x, ", argb);
+ }
+ fprintf(stderr, "\n");
+ }
+ fprintf(stderr, "};\n");
+ fprintf(stderr, "/*---------- end */\n");
+}
+#endif
+
+static void setup_mask_framebuffer(struct pipe_surface *surf,
+ VGint surf_width, VGint surf_height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_framebuffer_state fb;
+
+ memset(&fb, 0, sizeof(fb));
+ fb.width = surf_width;
+ fb.height = surf_height;
+ fb.nr_cbufs = 1;
+ fb.cbufs[0] = surf;
+ {
+ VGint i;
+ for (i = 1; i < PIPE_MAX_COLOR_BUFS; ++i)
+ fb.cbufs[i] = 0;
+ }
+ cso_set_framebuffer(ctx->cso_context, &fb);
+}
+
+
+/* setup shader constants */
+static void setup_mask_operation(VGMaskOperation operation)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_constant_buffer *cbuf = &ctx->mask.cbuf;
+ const VGint param_bytes = 4 * sizeof(VGfloat);
+ const VGfloat ones[4] = {1.f, 1.f, 1.f, 1.f};
+ void *shader = 0;
+
+ /* We always need to get a new buffer, to keep the drivers simple and
+ * avoid gratuitous rendering synchronization.
+ */
+ pipe_buffer_reference(&cbuf->buffer, NULL);
+
+ cbuf->buffer = pipe_buffer_create(ctx->pipe->screen, 1,
+ PIPE_BUFFER_USAGE_CONSTANT,
+ param_bytes);
+ if (cbuf->buffer) {
+ st_no_flush_pipe_buffer_write(ctx, cbuf->buffer,
+ 0, param_bytes, ones);
+ }
+
+ ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf);
+ switch (operation) {
+ case VG_UNION_MASK: {
+ if (!ctx->mask.union_fs) {
+ ctx->mask.union_fs = shader_create_from_text(ctx->pipe,
+ union_mask_asm,
+ 200,
+ PIPE_SHADER_FRAGMENT);
+ }
+ shader = ctx->mask.union_fs->driver;
+ }
+ break;
+ case VG_INTERSECT_MASK: {
+ if (!ctx->mask.intersect_fs) {
+ ctx->mask.intersect_fs = shader_create_from_text(ctx->pipe,
+ intersect_mask_asm,
+ 200,
+ PIPE_SHADER_FRAGMENT);
+ }
+ shader = ctx->mask.intersect_fs->driver;
+ }
+ break;
+ case VG_SUBTRACT_MASK: {
+ if (!ctx->mask.subtract_fs) {
+ ctx->mask.subtract_fs = shader_create_from_text(ctx->pipe,
+ subtract_mask_asm,
+ 200,
+ PIPE_SHADER_FRAGMENT);
+ }
+ shader = ctx->mask.subtract_fs->driver;
+ }
+ break;
+ case VG_SET_MASK: {
+ if (!ctx->mask.set_fs) {
+ ctx->mask.set_fs = shader_create_from_text(ctx->pipe,
+ set_mask_asm,
+ 200,
+ PIPE_SHADER_FRAGMENT);
+ }
+ shader = ctx->mask.set_fs->driver;
+ }
+ break;
+ default:
+ assert(0);
+ break;
+ }
+ cso_set_fragment_shader_handle(ctx->cso_context, shader);
+}
+
+static void setup_mask_samplers(struct pipe_texture *umask)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_sampler_state *samplers[PIPE_MAX_SAMPLERS];
+ struct pipe_texture *textures[PIPE_MAX_SAMPLERS];
+ struct st_framebuffer *fb_buffers = ctx->draw_buffer;
+ struct pipe_texture *uprev = NULL;
+ struct pipe_sampler_state sampler;
+
+ uprev = fb_buffers->blend_texture;
+ sampler = ctx->mask.sampler;
+ sampler.normalized_coords = 1;
+
+ samplers[0] = NULL;
+ samplers[1] = NULL;
+ samplers[2] = NULL;
+ textures[0] = NULL;
+ textures[1] = NULL;
+ textures[2] = NULL;
+
+ samplers[0] = &sampler;
+ samplers[1] = &ctx->mask.sampler;
+
+ textures[0] = umask;
+ textures[1] = uprev;
+
+ cso_set_samplers(ctx->cso_context, 2,
+ (const struct pipe_sampler_state **)samplers);
+ cso_set_sampler_textures(ctx->cso_context, 2, textures);
+}
+
+
+/* setup shader constants */
+static void setup_mask_fill(const VGfloat color[4])
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_constant_buffer *cbuf = &ctx->mask.cbuf;
+ const VGint param_bytes = 4 * sizeof(VGfloat);
+
+ /* We always need to get a new buffer, to keep the drivers simple and
+ * avoid gratuitous rendering synchronization.
+ */
+ pipe_buffer_reference(&cbuf->buffer, NULL);
+
+ cbuf->buffer = pipe_buffer_create(ctx->pipe->screen, 1,
+ PIPE_BUFFER_USAGE_CONSTANT,
+ param_bytes);
+ if (cbuf->buffer) {
+ st_no_flush_pipe_buffer_write(ctx, cbuf->buffer, 0, param_bytes, color);
+ }
+
+ ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf);
+ cso_set_fragment_shader_handle(ctx->cso_context,
+ shaders_cache_fill(ctx->sc,
+ VEGA_SOLID_FILL_SHADER));
+}
+
+static void setup_mask_viewport()
+{
+ struct vg_context *ctx = vg_current_context();
+ vg_set_viewport(ctx, VEGA_Y0_TOP);
+}
+
+static void setup_mask_blend()
+{
+ struct vg_context *ctx = vg_current_context();
+
+ struct pipe_blend_state blend;
+
+ memset(&blend, 0, sizeof(struct pipe_blend_state));
+ blend.blend_enable = 1;
+ blend.colormask |= PIPE_MASK_R;
+ blend.colormask |= PIPE_MASK_G;
+ blend.colormask |= PIPE_MASK_B;
+ blend.colormask |= PIPE_MASK_A;
+ blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE;
+ blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE;
+ blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO;
+ blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO;
+
+ cso_set_blend(ctx->cso_context, &blend);
+}
+
+
+static void surface_fill(struct pipe_surface *surf,
+ int surf_width, int surf_height,
+ int x, int y, int width, int height,
+ const VGfloat color[4])
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (x < 0) {
+ width += x;
+ x = 0;
+ }
+ if (y < 0) {
+ height += y;
+ y = 0;
+ }
+
+ cso_save_framebuffer(ctx->cso_context);
+ cso_save_blend(ctx->cso_context);
+ cso_save_fragment_shader(ctx->cso_context);
+ cso_save_viewport(ctx->cso_context);
+
+ setup_mask_blend();
+ setup_mask_fill(color);
+ setup_mask_framebuffer(surf, surf_width, surf_height);
+ setup_mask_viewport();
+
+ renderer_draw_quad(ctx->renderer, x, y,
+ x + width, y + height, 0.0f/*depth should be disabled*/);
+
+
+ /* make sure rendering has completed */
+ ctx->pipe->flush(ctx->pipe,
+ PIPE_FLUSH_RENDER_CACHE | PIPE_FLUSH_FRAME,
+ NULL);
+
+#if DEBUG_MASKS
+ save_alpha_to_file(0);
+#endif
+
+ cso_restore_blend(ctx->cso_context);
+ cso_restore_framebuffer(ctx->cso_context);
+ cso_restore_fragment_shader(ctx->cso_context);
+ cso_restore_viewport(ctx->cso_context);
+}
+
+
+static void mask_using_texture(struct pipe_texture *texture,
+ VGMaskOperation operation,
+ VGint x, VGint y,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct pipe_surface *surface =
+ alpha_mask_surface(ctx, PIPE_BUFFER_USAGE_GPU_WRITE);
+ VGint offsets[4], loc[4];
+
+ if (!surface)
+ return;
+ if (!intersect_rectangles(surface->width, surface->height,
+ texture->width[0], texture->height[0],
+ x, y, width, height,
+ offsets, loc))
+ return;
+#if 0
+ debug_printf("Offset = [%d, %d, %d, %d]\n", offsets[0],
+ offsets[1], offsets[2], offsets[3]);
+ debug_printf("Locati = [%d, %d, %d, %d]\n", loc[0],
+ loc[1], loc[2], loc[3]);
+#endif
+
+ /* prepare our blend surface */
+ vg_prepare_blend_surface_from_mask(ctx);
+
+ cso_save_samplers(ctx->cso_context);
+ cso_save_sampler_textures(ctx->cso_context);
+ cso_save_framebuffer(ctx->cso_context);
+ cso_save_blend(ctx->cso_context);
+ cso_save_fragment_shader(ctx->cso_context);
+ cso_save_viewport(ctx->cso_context);
+
+ setup_mask_samplers(texture);
+ setup_mask_blend();
+ setup_mask_operation(operation);
+ setup_mask_framebuffer(surface, surface->width, surface->height);
+ setup_mask_viewport();
+
+ /* render the quad to propagate the rendering from stencil */
+ renderer_draw_texture(ctx->renderer, texture,
+ offsets[0], offsets[1],
+ offsets[0] + offsets[2], offsets[1] + offsets[3],
+ loc[0], loc[1], loc[0] + loc[2], loc[1] + loc[3]);
+
+ /* make sure rendering has completed */
+ ctx->pipe->flush(ctx->pipe, PIPE_FLUSH_RENDER_CACHE, NULL);
+ cso_restore_blend(ctx->cso_context);
+ cso_restore_framebuffer(ctx->cso_context);
+ cso_restore_fragment_shader(ctx->cso_context);
+ cso_restore_samplers(ctx->cso_context);
+ cso_restore_sampler_textures(ctx->cso_context);
+ cso_restore_viewport(ctx->cso_context);
+
+ pipe_surface_reference(&surface, NULL);
+}
+
+
+#ifdef OPENVG_VERSION_1_1
+
+struct vg_mask_layer * mask_layer_create(VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct vg_mask_layer *mask = 0;
+
+ mask = CALLOC_STRUCT(vg_mask_layer);
+ vg_init_object(&mask->base, ctx, VG_OBJECT_MASK);
+ mask->width = width;
+ mask->height = height;
+
+ {
+ struct pipe_texture pt;
+ struct pipe_screen *screen = ctx->pipe->screen;
+
+ memset(&pt, 0, sizeof(pt));
+ pt.target = PIPE_TEXTURE_2D;
+ pt.format = PIPE_FORMAT_A8R8G8B8_UNORM;
+ pf_get_block(PIPE_FORMAT_A8R8G8B8_UNORM, &pt.block);
+ pt.last_level = 0;
+ pt.width[0] = width;
+ pt.height[0] = height;
+ pt.depth[0] = 1;
+ pt.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER;
+ pt.compressed = 0;
+
+ mask->texture = screen->texture_create(screen, &pt);
+ }
+
+ vg_context_add_object(ctx, VG_OBJECT_MASK, mask);
+
+ return mask;
+}
+
+void mask_layer_destroy(struct vg_mask_layer *layer)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ vg_context_remove_object(ctx, VG_OBJECT_MASK, layer);
+ pipe_texture_release(&layer->texture);
+ free(layer);
+}
+
+void mask_layer_fill(struct vg_mask_layer *layer,
+ VGint x, VGint y,
+ VGint width, VGint height,
+ VGfloat value)
+{
+ struct vg_context *ctx = vg_current_context();
+ VGfloat alpha_color[4] = {0, 0, 0, 0};
+ struct pipe_surface *surface;
+
+ alpha_color[3] = value;
+
+ surface = ctx->pipe->screen->get_tex_surface(
+ ctx->pipe->screen, layer->texture,
+ 0, 0, 0,
+ PIPE_BUFFER_USAGE_GPU_WRITE);
+
+ surface_fill(surface,
+ layer->width, layer->height,
+ x, y, width, height, alpha_color);
+
+ ctx->pipe->screen->tex_surface_release(ctx->pipe->screen, &surface);
+}
+
+void mask_copy(struct vg_mask_layer *layer,
+ VGint sx, VGint sy,
+ VGint dx, VGint dy,
+ VGint width, VGint height)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct st_framebuffer *fb_buffers = ctx->draw_buffer;
+
+ renderer_copy_texture(ctx->renderer,
+ layer->texture,
+ sx, sy,
+ sx + width, sy + height,
+ fb_buffers->alpha_mask,
+ dx, dy,
+ dx + width, dy + height);
+}
+
+static void mask_layer_render_to(struct vg_mask_layer *layer,
+ struct path *path,
+ VGbitfield paint_modes)
+{
+ struct vg_context *ctx = vg_current_context();
+ const VGfloat fill_color[4] = {1.f, 1.f, 1.f, 1.f};
+ struct pipe_screen *screen = ctx->pipe->screen;
+ struct pipe_surface *surface;
+
+ surface = screen->get_tex_surface(screen, layer->texture, 0, 0, 0,
+ PIPE_BUFFER_USAGE_GPU_WRITE);
+
+ cso_save_framebuffer(ctx->cso_context);
+ cso_save_fragment_shader(ctx->cso_context);
+ cso_save_viewport(ctx->cso_context);
+
+ setup_mask_blend();
+ setup_mask_fill(fill_color);
+ setup_mask_framebuffer(surface, layer->width, layer->height);
+ setup_mask_viewport();
+
+ if (paint_modes & VG_FILL_PATH) {
+ struct matrix *mat = &ctx->state.vg.path_user_to_surface_matrix;
+ path_fill(path, mat);
+ }
+
+ if (paint_modes & VG_STROKE_PATH){
+ path_stroke(path);
+ }
+
+
+ /* make sure rendering has completed */
+ ctx->pipe->flush(ctx->pipe, PIPE_FLUSH_RENDER_CACHE, NULL);
+
+ cso_restore_framebuffer(ctx->cso_context);
+ cso_restore_fragment_shader(ctx->cso_context);
+ cso_restore_viewport(ctx->cso_context);
+ ctx->state.dirty |= BLEND_DIRTY;
+
+ screen->tex_surface_release(ctx->pipe->screen, &surface);
+}
+
+void mask_render_to(struct path *path,
+ VGbitfield paint_modes,
+ VGMaskOperation operation)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct st_framebuffer *fb_buffers = ctx->draw_buffer;
+ struct vg_mask_layer *temp_layer;
+ VGint width, height;
+
+ width = fb_buffers->alpha_mask->width[0];
+ height = fb_buffers->alpha_mask->width[0];
+
+ temp_layer = mask_layer_create(width, height);
+
+ mask_layer_render_to(temp_layer, path, paint_modes);
+
+ mask_using_layer(temp_layer, 0, 0, width, height,
+ operation);
+
+ mask_layer_destroy(temp_layer);
+}
+
+void mask_using_layer(struct vg_mask_layer *layer,
+ VGMaskOperation operation,
+ VGint x, VGint y,
+ VGint width, VGint height)
+{
+ mask_using_texture(layer->texture, operation,
+ x, y, width, height);
+}
+
+VGint mask_layer_width(struct vg_mask_layer *layer)
+{
+ return layer->width;
+}
+
+VGint mask_layer_height(struct vg_mask_layer *layer)
+{
+ return layer->height;
+}
+
+
+#endif
+
+void mask_using_image(struct vg_image *image,
+ VGMaskOperation operation,
+ VGint x, VGint y,
+ VGint width, VGint height)
+{
+ mask_using_texture(image->texture, operation,
+ x, y, width, height);
+}
+
+void mask_fill(VGint x, VGint y, VGint width, VGint height,
+ VGfloat value)
+{
+ struct vg_context *ctx = vg_current_context();
+ VGfloat alpha_color[4] = {.0f, .0f, .0f, value};
+ struct pipe_surface *surf = alpha_mask_surface(
+ ctx, PIPE_BUFFER_USAGE_GPU_WRITE);
+
+#if DEBUG_MASKS
+ debug_printf("mask_fill(%d, %d, %d, %d) with rgba(%f, %f, %f, %f)\n",
+ x, y, width, height,
+ alpha_color[0], alpha_color[1],
+ alpha_color[2], alpha_color[3]);
+ debug_printf("XXX %f === %f \n",
+ alpha_color[3], value);
+#endif
+
+ surface_fill(surf, surf->width, surf->height,
+ x, y, width, height, alpha_color);
+
+ pipe_surface_reference(&surf, NULL);
+}
+
+VGint mask_bind_samplers(struct pipe_sampler_state **samplers,
+ struct pipe_texture **textures)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ if (ctx->state.vg.masking) {
+ struct st_framebuffer *fb_buffers = ctx->draw_buffer;
+
+ samplers[1] = &ctx->mask.sampler;
+ textures[1] = fb_buffers->alpha_mask;
+ return 1;
+ } else
+ return 0;
+}
diff --git a/src/gallium/state_trackers/vega/mask.h b/src/gallium/state_trackers/vega/mask.h
new file mode 100644
index 00000000000..5eaaede0e3a
--- /dev/null
+++ b/src/gallium/state_trackers/vega/mask.h
@@ -0,0 +1,68 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef MASK_H
+#define MASK_H
+
+#include "vg_context.h"
+
+struct path;
+struct vg_image;
+struct pipe_texture;
+
+struct vg_mask_layer *mask_layer_create(VGint width, VGint height);
+void mask_layer_destroy(struct vg_mask_layer *layer);
+void mask_layer_fill(struct vg_mask_layer *layer,
+ VGint x, VGint y,
+ VGint width, VGint height,
+ VGfloat value);
+VGint mask_layer_width(struct vg_mask_layer *layer);
+VGint mask_layer_height(struct vg_mask_layer *layer);
+void mask_copy(struct vg_mask_layer *layer,
+ VGint sx, VGint sy,
+ VGint dx, VGint dy,
+ VGint width, VGint height);
+
+void mask_render_to(struct path *path,
+ VGbitfield paint_modes,
+ VGMaskOperation operation);
+
+void mask_using_layer(struct vg_mask_layer *layer,
+ VGMaskOperation operation,
+ VGint x, VGint y,
+ VGint width, VGint height);
+void mask_using_image(struct vg_image *image,
+ VGMaskOperation operation,
+ VGint x, VGint y,
+ VGint width, VGint height);
+void mask_fill(VGint x, VGint y,
+ VGint width, VGint height,
+ VGfloat value);
+
+VGint mask_bind_samplers(struct pipe_sampler_state **samplers,
+ struct pipe_texture **textures);
+
+#endif
diff --git a/src/gallium/state_trackers/vega/matrix.h b/src/gallium/state_trackers/vega/matrix.h
new file mode 100644
index 00000000000..4c207f912a8
--- /dev/null
+++ b/src/gallium/state_trackers/vega/matrix.h
@@ -0,0 +1,462 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef MATRIX_H
+#define MATRIX_H
+
+#include "VG/openvg.h"
+
+#include "pipe/p_compiler.h"
+#include "util/u_math.h"
+
+#include <stdio.h>
+#include <math.h>
+
+#define floatsEqual(x, y) (fabs(x - y) <= 0.00001f * MIN2(fabs(x), fabs(y)))
+#define floatIsZero(x) (floatsEqual((x) + 1, 1))
+#define ABS(x) (fabsf(x))
+
+#define DEGREES_TO_RADIANS(d) (0.0174532925199 * (d))
+#define FLT_TO_INT(flt) float_to_int_floor(((VGuint*)&(flt))[0])
+
+static INLINE VGint float_to_int_floor(VGuint bits)
+{
+ int sign = (bits >> 31) ? -1 : 1;
+ int exp = ((bits >> 23) & 255) - 127;
+ int mant = bits & 0x007fffff;
+ int sh = 23 - exp;
+
+ /* abs(value) >= 2^31 -> clamp. */
+
+ if (exp >= 31)
+ return (VGint)((sign < 0) ? 0x80000000u : 0x7fffffffu);
+
+ /* abs(value) < 1 -> return -1 or 0. */
+
+ if (exp < 0)
+ return (sign < 0 && (exp > -127 || mant != 0)) ? -1 : 0;
+
+ /* abs(value) >= 2^23 -> shift left. */
+
+ mant |= 0x00800000;
+ if (sh <= 0)
+ return sign * (mant << -sh);
+
+ /* Negative -> add a rounding term. */
+
+ if (sign < 0)
+ mant += (1 << sh) - 1;
+
+ /* Shift right to obtain the result. */
+
+ return sign * (mant >> sh);
+}
+
+
+struct matrix {
+ VGfloat m[9];
+};
+
+static INLINE void matrix_init(struct matrix *mat,
+ const VGfloat *val)
+{
+ memcpy(mat->m, val, sizeof(VGfloat) * 9);
+}
+
+static INLINE void matrix_inits(struct matrix *mat,
+ VGfloat m11, VGfloat m12, VGfloat m13,
+ VGfloat m21, VGfloat m22, VGfloat m23,
+ VGfloat m31, VGfloat m32, VGfloat m33)
+{
+ mat->m[0] = m11; mat->m[1] = m12; mat->m[2] = m13;
+ mat->m[3] = m21; mat->m[4] = m22; mat->m[5] = m23;
+ mat->m[6] = m31; mat->m[7] = m32; mat->m[8] = m33;
+}
+
+static INLINE void matrix_load_identity(struct matrix *matrix)
+{
+ static const VGfloat identity[9] = {1.f, 0.f, 0.f,
+ 0.f, 1.f, 0.f,
+ 0.f, 0.f, 1.f};
+ memcpy(matrix->m, identity, sizeof(identity));
+}
+
+static INLINE VGboolean matrix_is_identity(struct matrix *matrix)
+{
+ return floatsEqual(matrix->m[0], 1) && floatIsZero(matrix->m[1]) &&
+ floatIsZero(matrix->m[2]) &&
+ floatIsZero(matrix->m[3]) && floatsEqual(matrix->m[4], 1) &&
+ floatIsZero(matrix->m[5]) &&
+ floatIsZero(matrix->m[6]) && floatIsZero(matrix->m[7]) &&
+ floatIsZero(matrix->m[8]);
+}
+
+static INLINE VGboolean matrix_is_affine(struct matrix *matrix)
+{
+ return floatIsZero(matrix->m[2]) && floatIsZero(matrix->m[5])
+ && floatsEqual(matrix->m[8], 1);
+}
+
+
+static INLINE void matrix_make_affine(struct matrix *matrix)
+{
+ matrix->m[2] = 0.f;
+ matrix->m[5] = 0.f;
+ matrix->m[8] = 1.f;
+}
+
+static INLINE void matrix_mult(struct matrix *dst,
+ struct matrix *src)
+{
+ VGfloat m11 = dst->m[0]*src->m[0] + dst->m[3]*src->m[1] + dst->m[6]*src->m[2];
+ VGfloat m12 = dst->m[0]*src->m[3] + dst->m[3]*src->m[4] + dst->m[6]*src->m[5];
+ VGfloat m13 = dst->m[0]*src->m[6] + dst->m[3]*src->m[7] + dst->m[6]*src->m[8];
+
+ VGfloat m21 = dst->m[1]*src->m[0] + dst->m[4]*src->m[1] + dst->m[7]*src->m[2];
+ VGfloat m22 = dst->m[1]*src->m[3] + dst->m[4]*src->m[4] + dst->m[7]*src->m[5];
+ VGfloat m23 = dst->m[1]*src->m[6] + dst->m[4]*src->m[7] + dst->m[7]*src->m[8];
+
+ VGfloat m31 = dst->m[2]*src->m[0] + dst->m[5]*src->m[1] + dst->m[8]*src->m[2];
+ VGfloat m32 = dst->m[2]*src->m[3] + dst->m[5]*src->m[4] + dst->m[8]*src->m[5];
+ VGfloat m33 = dst->m[2]*src->m[6] + dst->m[5]*src->m[7] + dst->m[8]*src->m[8];
+
+ dst->m[0] = m11; dst->m[1] = m21; dst->m[2] = m31;
+ dst->m[3] = m12; dst->m[4] = m22; dst->m[5] = m32;
+ dst->m[6] = m13; dst->m[7] = m23; dst->m[8] = m33;
+}
+
+
+static INLINE void matrix_map_point(struct matrix *mat,
+ VGfloat x, VGfloat y,
+ VGfloat *out_x, VGfloat *out_y)
+{
+ /* to be able to do matrix_map_point(m, x, y, &x, &y) use
+ * temporaries */
+ VGfloat tmp_x = x, tmp_y = y;
+
+ *out_x = mat->m[0]*tmp_x + mat->m[3]*tmp_y + mat->m[6];
+ *out_y = mat->m[1]*tmp_x + mat->m[4]*tmp_y + mat->m[7];
+ if (!matrix_is_affine(mat)) {
+ VGfloat w = 1/(mat->m[2]*tmp_x + mat->m[5]*tmp_y + mat->m[8]);
+ *out_x *= w;
+ *out_y *= w;
+ }
+}
+
+static INLINE void matrix_translate(struct matrix *dst,
+ VGfloat tx, VGfloat ty)
+{
+ if (!matrix_is_affine(dst)) {
+ struct matrix trans_matrix;
+ matrix_load_identity(&trans_matrix);
+ trans_matrix.m[6] = tx;
+ trans_matrix.m[7] = ty;
+ matrix_mult(dst, &trans_matrix);
+ } else {
+ dst->m[6] += tx*dst->m[0] + ty*dst->m[3];
+ dst->m[7] += ty*dst->m[4] + tx*dst->m[1];
+ }
+}
+
+static INLINE void matrix_scale(struct matrix *dst,
+ VGfloat sx, VGfloat sy)
+{
+ if (!matrix_is_affine(dst)) {
+ struct matrix scale_matrix;
+ matrix_load_identity(&scale_matrix);
+ scale_matrix.m[0] = sx;
+ scale_matrix.m[4] = sy;
+ matrix_mult(dst, &scale_matrix);
+ } else {
+ dst->m[0] *= sx; dst->m[1] *= sx;
+ dst->m[3] *= sy; dst->m[4] *= sy;
+ }
+}
+
+static INLINE void matrix_shear(struct matrix *dst,
+ VGfloat shx, VGfloat shy)
+{
+ struct matrix shear_matrix;
+ matrix_load_identity(&shear_matrix);
+ shear_matrix.m[1] = shy;
+ shear_matrix.m[3] = shx;
+ matrix_mult(dst, &shear_matrix);
+}
+
+static INLINE void matrix_rotate(struct matrix *dst,
+ VGfloat angle)
+{
+ struct matrix mat;
+ float sin_val = 0;
+ float cos_val = 0;
+
+
+ if (floatsEqual(angle, 90) || floatsEqual(angle, -270))
+ sin_val = 1.f;
+ else if (floatsEqual(angle, 270) || floatsEqual(angle, -90))
+ sin_val = -1.f;
+ else if (floatsEqual(angle, 180))
+ cos_val = -1.f;
+ else {
+ float radians = DEGREES_TO_RADIANS(angle);
+ sin_val = sin(radians);
+ cos_val = cos(radians);
+ }
+
+ if (!matrix_is_affine(dst)) {
+ matrix_load_identity(&mat);
+ mat.m[0] = cos_val; mat.m[1] = sin_val;
+ mat.m[3] = -sin_val; mat.m[4] = cos_val;
+
+ matrix_mult(dst, &mat);
+ } else {
+ VGfloat m11 = cos_val*dst->m[0] + sin_val*dst->m[3];
+ VGfloat m12 = cos_val*dst->m[1] + sin_val*dst->m[4];
+ VGfloat m21 = -sin_val*dst->m[0] + cos_val*dst->m[3];
+ VGfloat m22 = -sin_val*dst->m[1] + cos_val*dst->m[4];
+ dst->m[0] = m11; dst->m[1] = m12;
+ dst->m[3] = m21; dst->m[4] = m22;
+ }
+}
+
+
+static INLINE VGfloat matrix_determinant(struct matrix *mat)
+{
+ return mat->m[0]*(mat->m[8]*mat->m[4]-mat->m[7]*mat->m[5]) -
+ mat->m[3]*(mat->m[8]*mat->m[1]-mat->m[7]*mat->m[2])+
+ mat->m[6]*(mat->m[5]*mat->m[1]-mat->m[4]*mat->m[2]);
+}
+
+
+static INLINE void matrix_adjoint(struct matrix *mat)
+{
+ VGfloat h[9];
+ h[0] = mat->m[4]*mat->m[8] - mat->m[5]*mat->m[7];
+ h[3] = mat->m[5]*mat->m[6] - mat->m[3]*mat->m[8];
+ h[6] = mat->m[3]*mat->m[7] - mat->m[4]*mat->m[6];
+ h[1] = mat->m[2]*mat->m[7] - mat->m[1]*mat->m[8];
+ h[4] = mat->m[0]*mat->m[8] - mat->m[2]*mat->m[6];
+ h[7] = mat->m[1]*mat->m[6] - mat->m[0]*mat->m[7];
+ h[2] = mat->m[1]*mat->m[5] - mat->m[2]*mat->m[4];
+ h[5] = mat->m[2]*mat->m[3] - mat->m[0]*mat->m[5];
+ h[8] = mat->m[0]*mat->m[4] - mat->m[1]*mat->m[3];
+
+
+ memcpy(mat->m, h, sizeof(VGfloat) * 9);
+}
+
+static INLINE void matrix_divs(struct matrix *mat,
+ VGfloat s)
+{
+ mat->m[0] /= s;
+ mat->m[1] /= s;
+ mat->m[2] /= s;
+ mat->m[3] /= s;
+ mat->m[4] /= s;
+ mat->m[5] /= s;
+ mat->m[6] /= s;
+ mat->m[7] /= s;
+ mat->m[8] /= s;
+}
+
+static INLINE VGboolean matrix_invert(struct matrix *mat)
+{
+ VGfloat det = matrix_determinant(mat);
+
+ if (floatIsZero(det))
+ return VG_FALSE;
+
+ matrix_adjoint(mat);
+ matrix_divs(mat, det);
+ return VG_TRUE;
+}
+
+static INLINE VGboolean matrix_is_invertible(struct matrix *mat)
+{
+ return !floatIsZero(matrix_determinant(mat));
+}
+
+
+static INLINE VGboolean matrix_square_to_quad(VGfloat dx0, VGfloat dy0,
+ VGfloat dx1, VGfloat dy1,
+ VGfloat dx3, VGfloat dy3,
+ VGfloat dx2, VGfloat dy2,
+ struct matrix *mat)
+{
+ VGfloat ax = dx0 - dx1 + dx2 - dx3;
+ VGfloat ay = dy0 - dy1 + dy2 - dy3;
+
+ if (floatIsZero(ax) && floatIsZero(ay)) {
+ /* affine case */
+ matrix_inits(mat,
+ dx1 - dx0, dy1 - dy0, 0,
+ dx2 - dx1, dy2 - dy1, 0,
+ dx0, dy0, 1);
+ } else {
+ VGfloat a, b, c, d, e, f, g, h;
+ VGfloat ax1 = dx1 - dx2;
+ VGfloat ax2 = dx3 - dx2;
+ VGfloat ay1 = dy1 - dy2;
+ VGfloat ay2 = dy3 - dy2;
+
+ /* determinants */
+ VGfloat gtop = ax * ay2 - ax2 * ay;
+ VGfloat htop = ax1 * ay - ax * ay1;
+ VGfloat bottom = ax1 * ay2 - ax2 * ay1;
+
+ if (!bottom)
+ return VG_FALSE;
+
+ g = gtop / bottom;
+ h = htop / bottom;
+
+ a = dx1 - dx0 + g * dx1;
+ b = dx3 - dx0 + h * dx3;
+ c = dx0;
+ d = dy1 - dy0 + g * dy1;
+ e = dy3 - dy0 + h * dy3;
+ f = dy0;
+
+ matrix_inits(mat,
+ a, d, g,
+ b, e, h,
+ c, f, 1.f);
+ }
+
+ return VG_TRUE;
+}
+
+static INLINE VGboolean matrix_quad_to_square(VGfloat sx0, VGfloat sy0,
+ VGfloat sx1, VGfloat sy1,
+ VGfloat sx2, VGfloat sy2,
+ VGfloat sx3, VGfloat sy3,
+ struct matrix *mat)
+{
+ if (!matrix_square_to_quad(sx0, sy0, sx1, sy1,
+ sx2, sy2, sx3, sy3,
+ mat))
+ return VG_FALSE;
+
+ return matrix_invert(mat);
+}
+
+
+static INLINE VGboolean matrix_quad_to_quad(VGfloat dx0, VGfloat dy0,
+ VGfloat dx1, VGfloat dy1,
+ VGfloat dx2, VGfloat dy2,
+ VGfloat dx3, VGfloat dy3,
+ VGfloat sx0, VGfloat sy0,
+ VGfloat sx1, VGfloat sy1,
+ VGfloat sx2, VGfloat sy2,
+ VGfloat sx3, VGfloat sy3,
+ struct matrix *mat)
+{
+ struct matrix sqr_to_qd;
+
+ if (!matrix_square_to_quad(dx0, dy0, dx1, dy1,
+ dx2, dy2, dx3, dy3,
+ mat))
+ return VG_FALSE;
+
+ if (!matrix_quad_to_square(sx0, sy0, sx1, sy1,
+ sx2, sy2, sx3, sy3,
+ &sqr_to_qd))
+ return VG_FALSE;
+
+ matrix_mult(mat, &sqr_to_qd);
+
+ return VG_TRUE;
+}
+
+
+static INLINE VGboolean null_line(const VGfloat *l)
+{
+ return floatsEqual(l[0], l[2]) && floatsEqual(l[1], l[3]);
+}
+
+static INLINE void line_normal(float *l, float *norm)
+{
+ norm[0] = l[0];
+ norm[1] = l[1];
+
+ norm[2] = l[0] + (l[3] - l[1]);
+ norm[3] = l[1] - (l[2] - l[0]);
+}
+
+static INLINE void line_normalize(float *l)
+{
+ float x = l[2] - l[0];
+ float y = l[3] - l[1];
+ float len = sqrt(x*x + y*y);
+ l[2] = l[0] + x/len;
+ l[3] = l[1] + y/len;
+}
+
+static INLINE VGfloat line_length(VGfloat x1, VGfloat y1,
+ VGfloat x2, VGfloat y2)
+{
+ VGfloat x = x2 - x1;
+ VGfloat y = y2 - y1;
+ return sqrt(x*x + y*y);
+}
+
+static INLINE VGfloat line_lengthv(const VGfloat *l)
+{
+ VGfloat x = l[2] - l[0];
+ VGfloat y = l[3] - l[1];
+ return sqrt(x*x + y*y);
+}
+
+
+static INLINE void line_point_at(float *l, float t, float *pt)
+{
+ float dx = l[2] - l[0];
+ float dy = l[3] - l[1];
+
+ pt[0] = l[0] + dx * t;
+ pt[1] = l[1] + dy * t;
+}
+
+static INLINE void vector_unit(float *vec)
+{
+ float len = sqrt(vec[0] * vec[0] + vec[1] * vec[1]);
+ vec[0] /= len;
+ vec[1] /= len;
+}
+
+static INLINE void line_normal_vector(float *line, float *vec)
+{
+ VGfloat normal[4];
+
+ line_normal(line, normal);
+
+ vec[0] = normal[2] - normal[0];
+ vec[1] = normal[3] - normal[1];
+
+ vector_unit(vec);
+}
+
+#endif
diff --git a/src/gallium/state_trackers/vega/paint.c b/src/gallium/state_trackers/vega/paint.c
new file mode 100644
index 00000000000..04a6ba9cdcd
--- /dev/null
+++ b/src/gallium/state_trackers/vega/paint.c
@@ -0,0 +1,699 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "paint.h"
+
+#include "shaders_cache.h"
+#include "matrix.h"
+#include "image.h"
+#include "st_inlines.h"
+
+#include "pipe/p_compiler.h"
+#include "pipe/p_inlines.h"
+
+#include "util/u_memory.h"
+#include "util/u_math.h"
+
+#include "cso_cache/cso_context.h"
+
+struct vg_paint {
+ struct vg_object base;
+
+ VGPaintType type;
+
+ struct {
+ VGfloat color[4];
+ VGint colori[4];
+ } solid;
+
+ struct {
+ VGColorRampSpreadMode spread;
+ VGuint color_data[1024];
+ struct {
+ VGfloat coords[4];
+ VGint coordsi[4];
+ } linear;
+ struct {
+ VGfloat vals[5];
+ VGint valsi[5];
+ } radial;
+ struct pipe_texture *texture;
+ struct pipe_sampler_state sampler;
+
+ VGfloat *ramp_stops;
+ VGint *ramp_stopsi;
+ VGint num_stops;
+
+ VGboolean color_ramps_premultiplied;
+ } gradient;
+
+ struct {
+ struct pipe_texture *texture;
+ VGTilingMode tiling_mode;
+ struct pipe_sampler_state sampler;
+ } pattern;
+
+ struct pipe_constant_buffer cbuf;
+ struct pipe_shader_state fs_state;
+ void *fs;
+};
+
+static INLINE VGuint mix_pixels(VGuint p1, VGuint a, VGuint p2, VGuint b)
+{
+ VGuint t = (p1 & 0xff00ff) * a + (p2 & 0xff00ff) * b;
+ t >>= 8; t &= 0xff00ff;
+
+ p1 = ((p1 >> 8) & 0xff00ff) * a + ((p2 >> 8) & 0xff00ff) * b;
+ p1 &= 0xff00ff00; p1 |= t;
+
+ return p1;
+}
+
+static INLINE VGuint float4_to_argb(const VGfloat *clr)
+{
+ return float_to_ubyte(clr[3]) << 24 |
+ float_to_ubyte(clr[0]) << 16 |
+ float_to_ubyte(clr[1]) << 8 |
+ float_to_ubyte(clr[2]) << 0;
+}
+
+static INLINE void create_gradient_data(const VGfloat *ramp_stops,
+ VGint num,
+ VGuint *data,
+ VGint size)
+{
+ VGint i;
+ VGint pos = 0;
+ VGfloat fpos = 0, incr = 1.f / size;
+ VGuint last_color;
+
+ while (fpos < ramp_stops[0]) {
+ data[pos] = float4_to_argb(ramp_stops + 1);
+ fpos += incr;
+ ++pos;
+ }
+
+ for (i = 0; i < num - 1; ++i) {
+ VGint rcur = 5 * i;
+ VGint rnext = 5 * (i + 1);
+ VGfloat delta = 1.f/(ramp_stops[rnext] - ramp_stops[rcur]);
+ while (fpos < ramp_stops[rnext] && pos < size) {
+ VGint dist = 256 * ((fpos - ramp_stops[rcur]) * delta);
+ VGint idist = 256 - dist;
+ VGuint current_color = float4_to_argb(ramp_stops + rcur + 1);
+ VGuint next_color = float4_to_argb(ramp_stops + rnext + 1);
+ data[pos] = mix_pixels(current_color, idist,
+ next_color, dist);
+ fpos += incr;
+ ++pos;
+ }
+ }
+
+ last_color = float4_to_argb(ramp_stops + ((num - 1) * 5 + 1));
+ while (pos < size) {
+ data[pos] = last_color;
+ ++pos;
+ }
+ data[size-1] = last_color;
+}
+
+static INLINE struct pipe_texture *create_gradient_texture(struct vg_paint *p)
+{
+ struct pipe_context *pipe = p->base.ctx->pipe;
+ struct pipe_screen *screen = pipe->screen;
+ struct pipe_texture *tex = 0;
+ struct pipe_texture templ;
+
+ memset(&templ, 0, sizeof(templ));
+ templ.target = PIPE_TEXTURE_1D;
+ templ.format = PIPE_FORMAT_A8R8G8B8_UNORM;
+ templ.last_level = 0;
+ templ.width[0] = 1024;
+ templ.height[0] = 1;
+ templ.depth[0] = 1;
+ pf_get_block(PIPE_FORMAT_A8R8G8B8_UNORM, &templ.block);
+ templ.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER;
+
+ tex = screen->texture_create(screen, &templ);
+
+ { /* upload color_data */
+ struct pipe_transfer *transfer =
+ st_no_flush_get_tex_transfer(p->base.ctx, tex, 0, 0, 0,
+ PIPE_TRANSFER_WRITE, 0, 0, 1024, 1);
+ void *map = screen->transfer_map(screen, transfer);
+ memcpy(map, p->gradient.color_data, sizeof(VGint)*1024);
+ screen->transfer_unmap(screen, transfer);
+ screen->tex_transfer_destroy(transfer);
+ }
+
+ return tex;
+}
+
+struct vg_paint * paint_create(struct vg_context *ctx)
+{
+ struct vg_paint *paint = CALLOC_STRUCT(vg_paint);
+ const VGfloat default_color[] = {0.0f, 0.0f, 0.0f, 1.0f};
+ const VGfloat def_ling[] = {0.0f, 0.0f, 1.0f, 0.0f};
+ const VGfloat def_radg[] = {0.0f, 0.0f, 0.0f, 0.0f, 1.0f};
+ vg_init_object(&paint->base, ctx, VG_OBJECT_PAINT);
+ vg_context_add_object(ctx, VG_OBJECT_PAINT, paint);
+
+ paint->type = VG_PAINT_TYPE_COLOR;
+ memcpy(paint->solid.color, default_color,
+ 4 * sizeof(VGfloat));
+ paint->gradient.spread = VG_COLOR_RAMP_SPREAD_PAD;
+ memcpy(paint->gradient.linear.coords, def_ling,
+ 4 * sizeof(VGfloat));
+ memcpy(paint->gradient.radial.vals, def_radg,
+ 5 * sizeof(VGfloat));
+
+ paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ paint->gradient.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ paint->gradient.sampler.min_img_filter = PIPE_TEX_MIPFILTER_NEAREST;
+ paint->gradient.sampler.mag_img_filter = PIPE_TEX_MIPFILTER_NEAREST;
+ paint->gradient.sampler.normalized_coords = 1;
+
+ memcpy(&paint->pattern.sampler,
+ &paint->gradient.sampler,
+ sizeof(struct pipe_sampler_state));
+
+ return paint;
+}
+
+void paint_destroy(struct vg_paint *paint)
+{
+ struct vg_context *ctx = paint->base.ctx;
+ if (paint->pattern.texture)
+ pipe_texture_reference(&paint->pattern.texture, NULL);
+ if (ctx)
+ vg_context_remove_object(ctx, VG_OBJECT_PAINT, paint);
+
+ free(paint->gradient.ramp_stopsi);
+ free(paint->gradient.ramp_stops);
+ free(paint);
+}
+
+void paint_set_color(struct vg_paint *paint,
+ const VGfloat *color)
+{
+ paint->solid.color[0] = color[0];
+ paint->solid.color[1] = color[1];
+ paint->solid.color[2] = color[2];
+ paint->solid.color[3] = color[3];
+
+ paint->solid.colori[0] = FLT_TO_INT(color[0]);
+ paint->solid.colori[1] = FLT_TO_INT(color[1]);
+ paint->solid.colori[2] = FLT_TO_INT(color[2]);
+ paint->solid.colori[3] = FLT_TO_INT(color[3]);
+}
+
+static INLINE void paint_color_buffer(struct vg_paint *paint, void *buffer)
+{
+ VGfloat *map = (VGfloat*)buffer;
+ memcpy(buffer, paint->solid.color, 4 * sizeof(VGfloat));
+ map[4] = 0.f;
+ map[5] = 1.f;
+ map[6] = 2.f;
+ map[7] = 4.f;
+}
+
+static INLINE void paint_linear_gradient_buffer(struct vg_paint *paint, void *buffer)
+{
+ struct vg_context *ctx = paint->base.ctx;
+ VGfloat *map = (VGfloat*)buffer;
+
+ map[0] = paint->gradient.linear.coords[2] - paint->gradient.linear.coords[0];
+ map[1] = paint->gradient.linear.coords[3] - paint->gradient.linear.coords[1];
+ map[2] = 1.f / (map[0] * map[0] + map[1] * map[1]);
+ map[3] = 1.f;
+
+ map[4] = 0.f;
+ map[5] = 1.f;
+ map[6] = 2.f;
+ map[7] = 4.f;
+ {
+ struct matrix mat;
+ struct matrix inv;
+ matrix_load_identity(&mat);
+ matrix_translate(&mat, -paint->gradient.linear.coords[0], -paint->gradient.linear.coords[1]);
+ memcpy(&inv, &ctx->state.vg.fill_paint_to_user_matrix,
+ sizeof(struct matrix));
+ matrix_invert(&inv);
+ matrix_mult(&inv, &mat);
+ memcpy(&mat, &inv,
+ sizeof(struct matrix));
+
+ map[8] = mat.m[0]; map[9] = mat.m[3]; map[10] = mat.m[6]; map[11] = 0.f;
+ map[12] = mat.m[1]; map[13] = mat.m[4]; map[14] = mat.m[7]; map[15] = 0.f;
+ map[16] = mat.m[2]; map[17] = mat.m[5]; map[18] = mat.m[8]; map[19] = 0.f;
+ }
+#if 0
+ debug_printf("Coords (%f, %f, %f, %f)\n",
+ map[0], map[1], map[2], map[3]);
+#endif
+}
+
+
+static INLINE void paint_radial_gradient_buffer(struct vg_paint *paint, void *buffer)
+{
+ VGfloat *radialCoords = paint->gradient.radial.vals;
+ struct vg_context *ctx = paint->base.ctx;
+
+ VGfloat *map = (VGfloat*)buffer;
+
+ map[0] = radialCoords[0] - radialCoords[2];
+ map[1] = radialCoords[1] - radialCoords[3];
+ map[2] = -map[0] * map[0] - map[1] * map[1] +
+ radialCoords[4] * radialCoords[4];
+ map[3] = 1.f;
+
+ map[4] = 0.f;
+ map[5] = 1.f;
+ map[6] = 2.f;
+ map[7] = 4.f;
+
+ {
+ struct matrix mat;
+ struct matrix inv;
+ matrix_load_identity(&mat);
+ matrix_translate(&mat, -radialCoords[2], -radialCoords[3]);
+ memcpy(&inv, &ctx->state.vg.fill_paint_to_user_matrix,
+ sizeof(struct matrix));
+ matrix_invert(&inv);
+ matrix_mult(&inv, &mat);
+ memcpy(&mat, &inv,
+ sizeof(struct matrix));
+
+ map[8] = mat.m[0]; map[9] = mat.m[3]; map[10] = mat.m[6]; map[11] = 0.f;
+ map[12] = mat.m[1]; map[13] = mat.m[4]; map[14] = mat.m[7]; map[15] = 0.f;
+ map[16] = mat.m[2]; map[17] = mat.m[5]; map[18] = mat.m[8]; map[19] = 0.f;
+ }
+
+#if 0
+ debug_printf("Coords (%f, %f, %f, %f)\n",
+ map[0], map[1], map[2], map[3]);
+#endif
+}
+
+
+static INLINE void paint_pattern_buffer(struct vg_paint *paint, void *buffer)
+{
+ struct vg_context *ctx = paint->base.ctx;
+
+ VGfloat *map = (VGfloat *)buffer;
+ memcpy(map, paint->solid.color, 4 * sizeof(VGfloat));
+
+ map[4] = 0.f;
+ map[5] = 1.f;
+ map[6] = paint->pattern.texture->width[0];
+ map[7] = paint->pattern.texture->height[0];
+ {
+ struct matrix mat;
+ memcpy(&mat, &ctx->state.vg.fill_paint_to_user_matrix,
+ sizeof(struct matrix));
+ matrix_invert(&mat);
+ {
+ struct matrix pm;
+ memcpy(&pm, &ctx->state.vg.path_user_to_surface_matrix,
+ sizeof(struct matrix));
+ matrix_invert(&pm);
+ matrix_mult(&pm, &mat);
+ memcpy(&mat, &pm, sizeof(struct matrix));
+ }
+
+ map[8] = mat.m[0]; map[9] = mat.m[3]; map[10] = mat.m[6]; map[11] = 0.f;
+ map[12] = mat.m[1]; map[13] = mat.m[4]; map[14] = mat.m[7]; map[15] = 0.f;
+ map[16] = mat.m[2]; map[17] = mat.m[5]; map[18] = mat.m[8]; map[19] = 0.f;
+ }
+}
+
+void paint_set_type(struct vg_paint *paint, VGPaintType type)
+{
+ paint->type = type;
+}
+
+void paint_set_ramp_stops(struct vg_paint *paint, const VGfloat *stops,
+ int num)
+{
+ const VGfloat default_stops[] = {0.0f, 0.0f, 0.0f, 0.0f, 1.0f,
+ 1.0f, 1.0f, 1.0f, 1.0f, 1.0f};
+ VGint i;
+ const VGint num_stops = num / 5;
+ VGfloat last_coord;
+
+ paint->gradient.num_stops = num;
+ if (num) {
+ free(paint->gradient.ramp_stops);
+ paint->gradient.ramp_stops = malloc(sizeof(VGfloat)*num);
+ memcpy(paint->gradient.ramp_stops, stops, sizeof(VGfloat)*num);
+ } else
+ return;
+
+ /* stops must be in increasing order. the last stop is 1.0. if the
+ * first one is bigger than 1 then the whole sequence is invalid*/
+ if (stops[0] > 1) {
+ stops = default_stops;
+ num = 10;
+ }
+ last_coord = stops[0];
+ for (i = 1; i < num_stops; ++i) {
+ VGint idx = 5 * i;
+ VGfloat coord = stops[idx];
+ if (!floatsEqual(last_coord, coord) && coord < last_coord) {
+ stops = default_stops;
+ num = 10;
+ break;
+ }
+ last_coord = coord;
+ }
+
+ create_gradient_data(stops, num / 5, paint->gradient.color_data,
+ 1024);
+
+ if (paint->gradient.texture) {
+ pipe_texture_reference(&paint->gradient.texture, NULL);
+ paint->gradient.texture = 0;
+ }
+
+ paint->gradient.texture = create_gradient_texture(paint);
+}
+
+void paint_set_colori(struct vg_paint *p,
+ VGuint rgba)
+{
+ p->solid.color[0] = ((rgba >> 24) & 0xff) / 255.f;
+ p->solid.color[1] = ((rgba >> 16) & 0xff) / 255.f;
+ p->solid.color[2] = ((rgba >> 8) & 0xff) / 255.f;
+ p->solid.color[3] = ((rgba >> 0) & 0xff) / 255.f;
+}
+
+VGuint paint_colori(struct vg_paint *p)
+{
+#define F2B(f) (float_to_ubyte(f))
+
+ return ((F2B(p->solid.color[0]) << 24) |
+ (F2B(p->solid.color[1]) << 16) |
+ (F2B(p->solid.color[2]) << 8) |
+ (F2B(p->solid.color[3]) << 0));
+#undef F2B
+}
+
+void paint_set_linear_gradient(struct vg_paint *paint,
+ const VGfloat *coords)
+{
+ memcpy(paint->gradient.linear.coords, coords, sizeof(VGfloat) * 4);
+}
+
+void paint_set_spread_mode(struct vg_paint *paint,
+ VGint mode)
+{
+ paint->gradient.spread = mode;
+ switch(mode) {
+ case VG_COLOR_RAMP_SPREAD_PAD:
+ paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ break;
+ case VG_COLOR_RAMP_SPREAD_REPEAT:
+ paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_REPEAT;
+ break;
+ case VG_COLOR_RAMP_SPREAD_REFLECT:
+ paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_MIRROR_REPEAT;
+ break;
+ }
+}
+
+VGColorRampSpreadMode paint_spread_mode(struct vg_paint *paint)
+{
+ return paint->gradient.spread;
+}
+
+void paint_set_radial_gradient(struct vg_paint *paint,
+ const VGfloat *values)
+{
+ memcpy(paint->gradient.radial.vals, values, sizeof(VGfloat) * 5);
+}
+
+void paint_set_pattern(struct vg_paint *paint,
+ struct vg_image *img)
+{
+ if (paint->pattern.texture)
+ pipe_texture_reference(&paint->pattern.texture, NULL);
+
+ paint->pattern.texture = 0;
+ pipe_texture_reference(&paint->pattern.texture,
+ img->texture);
+}
+
+void paint_set_pattern_tiling(struct vg_paint *paint,
+ VGTilingMode mode)
+{
+ paint->pattern.tiling_mode = mode;
+
+ switch(mode) {
+ case VG_TILE_FILL:
+ paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_BORDER;
+ paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_BORDER;
+ break;
+ case VG_TILE_PAD:
+ paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE;
+ break;
+ case VG_TILE_REPEAT:
+ paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_REPEAT;
+ paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_REPEAT;
+ break;
+ case VG_TILE_REFLECT:
+ paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_MIRROR_REPEAT;
+ paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_MIRROR_REPEAT;
+ break;
+ default:
+ debug_assert("!Unknown tiling mode");
+ }
+}
+
+void paint_get_color(struct vg_paint *paint,
+ VGfloat *color)
+{
+ color[0] = paint->solid.color[0];
+ color[1] = paint->solid.color[1];
+ color[2] = paint->solid.color[2];
+ color[3] = paint->solid.color[3];
+}
+
+void paint_ramp_stops(struct vg_paint *paint, VGfloat *stops,
+ int num)
+{
+ memcpy(stops, paint->gradient.ramp_stops, sizeof(VGfloat)*num);
+}
+
+void paint_linear_gradient(struct vg_paint *paint,
+ VGfloat *coords)
+{
+ memcpy(coords, paint->gradient.linear.coords, sizeof(VGfloat)*4);
+}
+
+void paint_radial_gradient(struct vg_paint *paint,
+ VGfloat *coords)
+{
+ memcpy(coords, paint->gradient.radial.vals, sizeof(VGfloat)*5);
+}
+
+int paint_num_ramp_stops(struct vg_paint *paint)
+{
+ return paint->gradient.num_stops;
+}
+
+VGPaintType paint_type(struct vg_paint *paint)
+{
+ return paint->type;
+}
+
+void paint_set_coloriv(struct vg_paint *paint,
+ const VGint *color)
+{
+ paint->solid.color[0] = color[0];
+ paint->solid.color[1] = color[1];
+ paint->solid.color[2] = color[2];
+ paint->solid.color[3] = color[3];
+
+ paint->solid.colori[0] = color[0];
+ paint->solid.colori[1] = color[1];
+ paint->solid.colori[2] = color[2];
+ paint->solid.colori[3] = color[3];
+}
+
+void paint_get_coloriv(struct vg_paint *paint,
+ VGint *color)
+{
+ color[0] = paint->solid.colori[0];
+ color[1] = paint->solid.colori[1];
+ color[2] = paint->solid.colori[2];
+ color[3] = paint->solid.colori[3];
+}
+
+void paint_set_color_ramp_premultiplied(struct vg_paint *paint,
+ VGboolean set)
+{
+ paint->gradient.color_ramps_premultiplied = set;
+}
+
+VGboolean paint_color_ramp_premultiplied(struct vg_paint *paint)
+{
+ return paint->gradient.color_ramps_premultiplied;
+}
+
+void paint_set_ramp_stopsi(struct vg_paint *paint, const VGint *stops,
+ int num)
+{
+ if (num) {
+ free(paint->gradient.ramp_stopsi);
+ paint->gradient.ramp_stopsi = malloc(sizeof(VGint)*num);
+ memcpy(paint->gradient.ramp_stopsi, stops, sizeof(VGint)*num);
+ }
+}
+
+void paint_ramp_stopsi(struct vg_paint *paint, VGint *stops,
+ int num)
+{
+ memcpy(stops, paint->gradient.ramp_stopsi, sizeof(VGint)*num);
+}
+
+void paint_set_linear_gradienti(struct vg_paint *paint,
+ const VGint *coords)
+{
+ memcpy(paint->gradient.linear.coordsi, coords, sizeof(VGint) * 4);
+}
+
+void paint_linear_gradienti(struct vg_paint *paint,
+ VGint *coords)
+{
+ memcpy(coords, paint->gradient.linear.coordsi, sizeof(VGint)*4);
+}
+
+void paint_set_radial_gradienti(struct vg_paint *paint,
+ const VGint *values)
+{
+ memcpy(paint->gradient.radial.valsi, values, sizeof(VGint) * 5);
+}
+
+void paint_radial_gradienti(struct vg_paint *paint,
+ VGint *coords)
+{
+ memcpy(coords, paint->gradient.radial.valsi, sizeof(VGint)*5);
+}
+
+VGTilingMode paint_pattern_tiling(struct vg_paint *paint)
+{
+ return paint->pattern.tiling_mode;
+}
+
+VGint paint_bind_samplers(struct vg_paint *paint, struct pipe_sampler_state **samplers,
+ struct pipe_texture **textures)
+{
+ struct vg_context *ctx = vg_current_context();
+
+ switch(paint->type) {
+ case VG_PAINT_TYPE_LINEAR_GRADIENT:
+ case VG_PAINT_TYPE_RADIAL_GRADIENT: {
+ if (paint->gradient.texture) {
+ paint->gradient.sampler.min_img_filter = image_sampler_filter(ctx);
+ paint->gradient.sampler.mag_img_filter = image_sampler_filter(ctx);
+ samplers[0] = &paint->gradient.sampler;
+ textures[0] = paint->gradient.texture;
+ return 1;
+ }
+ }
+ break;
+ case VG_PAINT_TYPE_PATTERN: {
+ memcpy(paint->pattern.sampler.border_color,
+ ctx->state.vg.tile_fill_color,
+ sizeof(VGfloat) * 4);
+ paint->pattern.sampler.min_img_filter = image_sampler_filter(ctx);
+ paint->pattern.sampler.mag_img_filter = image_sampler_filter(ctx);
+ samplers[0] = &paint->pattern.sampler;
+ textures[0] = paint->pattern.texture;
+ return 1;
+ }
+ break;
+ default:
+ samplers[0] = &paint->pattern.sampler; /* dummy */
+ textures[0] = 0;
+ return 0;
+ break;
+ }
+ return 0;
+}
+
+void paint_resolve_type(struct vg_paint *paint)
+{
+ if (paint->type == VG_PAINT_TYPE_PATTERN &&
+ !paint->pattern.texture) {
+ paint->type = VG_PAINT_TYPE_COLOR;
+ }
+}
+
+VGint paint_constant_buffer_size(struct vg_paint *paint)
+{
+ switch(paint->type) {
+ case VG_PAINT_TYPE_COLOR:
+ return 8 * sizeof(VGfloat);/*4 color + 4 constants (0.f,1.f,2.f,4.f)*/
+ break;
+ case VG_PAINT_TYPE_LINEAR_GRADIENT:
+ return 20 * sizeof(VGfloat);
+ break;
+ case VG_PAINT_TYPE_RADIAL_GRADIENT:
+ return 20 * sizeof(VGfloat);
+ break;
+ case VG_PAINT_TYPE_PATTERN:
+ return 20 * sizeof(VGfloat);
+ break;
+ default:
+ debug_printf("Uknown paint type: %d\n", paint->type);
+ }
+
+ return 0;
+}
+
+void paint_fill_constant_buffer(struct vg_paint *paint,
+ void *buffer)
+{
+ switch(paint->type) {
+ case VG_PAINT_TYPE_COLOR:
+ paint_color_buffer(paint, buffer);
+ break;
+ case VG_PAINT_TYPE_LINEAR_GRADIENT:
+ paint_linear_gradient_buffer(paint, buffer);
+ break;
+ case VG_PAINT_TYPE_RADIAL_GRADIENT:
+ paint_radial_gradient_buffer(paint, buffer);
+ break;
+ case VG_PAINT_TYPE_PATTERN:
+ paint_pattern_buffer(paint, buffer);
+ break;
+
+ default:
+ abort();
+ }
+}
diff --git a/src/gallium/state_trackers/vega/paint.h b/src/gallium/state_trackers/vega/paint.h
new file mode 100644
index 00000000000..999b5c167ca
--- /dev/null
+++ b/src/gallium/state_trackers/vega/paint.h
@@ -0,0 +1,118 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef PAINT_H
+#define PAINT_H
+
+#include "vg_context.h"
+
+#include "VG/openvg.h"
+#include "pipe/p_state.h"
+
+struct vg_paint;
+struct vg_image;
+struct pipe_sampler_state;
+struct pipe_texture;
+
+struct vg_paint *paint_create(struct vg_context *ctx);
+void paint_destroy(struct vg_paint *paint);
+
+void paint_set_color(struct vg_paint *paint,
+ const VGfloat *color);
+void paint_get_color(struct vg_paint *paint,
+ VGfloat *color);
+
+void paint_set_coloriv(struct vg_paint *paint,
+ const VGint *color);
+void paint_get_coloriv(struct vg_paint *paint,
+ VGint *color);
+
+void paint_set_colori(struct vg_paint *paint,
+ VGuint rgba);
+
+VGuint paint_colori(struct vg_paint *paint);
+
+void paint_set_type(struct vg_paint *paint, VGPaintType type);
+VGPaintType paint_type(struct vg_paint *paint);
+void paint_resolve_type(struct vg_paint *paint);
+
+void paint_set_linear_gradient(struct vg_paint *paint,
+ const VGfloat *coords);
+void paint_linear_gradient(struct vg_paint *paint,
+ VGfloat *coords);
+void paint_set_linear_gradienti(struct vg_paint *paint,
+ const VGint *coords);
+void paint_linear_gradienti(struct vg_paint *paint,
+ VGint *coords);
+
+
+void paint_set_radial_gradient(struct vg_paint *paint,
+ const VGfloat *values);
+void paint_radial_gradient(struct vg_paint *paint,
+ VGfloat *coords);
+void paint_set_radial_gradienti(struct vg_paint *paint,
+ const VGint *values);
+void paint_radial_gradienti(struct vg_paint *paint,
+ VGint *coords);
+
+
+void paint_set_ramp_stops(struct vg_paint *paint, const VGfloat *stops,
+ int num);
+void paint_ramp_stops(struct vg_paint *paint, VGfloat *stops,
+ int num);
+
+void paint_set_ramp_stopsi(struct vg_paint *paint, const VGint *stops,
+ int num);
+void paint_ramp_stopsi(struct vg_paint *paint, VGint *stops,
+ int num);
+
+int paint_num_ramp_stops(struct vg_paint *paint);
+
+void paint_set_spread_mode(struct vg_paint *paint,
+ VGint mode);
+VGColorRampSpreadMode paint_spread_mode(struct vg_paint *paint);
+
+
+void paint_set_pattern(struct vg_paint *paint,
+ struct vg_image *img);
+void paint_set_pattern_tiling(struct vg_paint *paint,
+ VGTilingMode mode);
+VGTilingMode paint_pattern_tiling(struct vg_paint *paint);
+
+void paint_set_color_ramp_premultiplied(struct vg_paint *paint,
+ VGboolean set);
+VGboolean paint_color_ramp_premultiplied(struct vg_paint *paint);
+
+
+VGint paint_bind_samplers(struct vg_paint *paint, struct pipe_sampler_state **samplers,
+ struct pipe_texture **textures);
+
+VGint paint_constant_buffer_size(struct vg_paint *paint);
+void paint_fill_constant_buffer(struct vg_paint *paint,
+ void *buffer);
+
+
+#endif
diff --git a/src/gallium/state_trackers/vega/path.c b/src/gallium/state_trackers/vega/path.c
new file mode 100644
index 00000000000..d04f9d9ae64
--- /dev/null
+++ b/src/gallium/state_trackers/vega/path.c
@@ -0,0 +1,2034 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "path.h"
+
+#include "stroker.h"
+#include "polygon.h"
+#include "bezier.h"
+#include "matrix.h"
+#include "vg_context.h"
+#include "util_array.h"
+#include "arc.h"
+#include "path_utils.h"
+#include "paint.h"
+#include "shader.h"
+
+#include "util/u_memory.h"
+
+#include <assert.h>
+
+#define DEBUG_PATH 0
+
+struct path {
+ struct vg_object base;
+ VGbitfield caps;
+ VGboolean dirty;
+ VGboolean dirty_stroke;
+
+ VGPathDatatype datatype;
+
+ VGfloat scale;
+ VGfloat bias;
+
+ VGint num_segments;
+
+ struct array * segments;
+ struct array * control_points;
+
+ struct {
+ struct polygon_array polygon_array;
+ struct matrix matrix;
+ } fill_polys;
+
+ struct {
+ struct path *path;
+ struct matrix matrix;
+ VGfloat stroke_width;
+ VGfloat miter_limit;
+ VGCapStyle cap_style;
+ VGJoinStyle join_style;
+ } stroked;
+};
+
+
+static INLINE void data_at(void **data,
+ struct path *p,
+ VGint start, VGint count,
+ VGfloat *out)
+{
+ VGPathDatatype dt = p->datatype;
+ VGint i;
+ VGint end = start + count;
+ VGfloat *itr = out;
+
+ switch(dt) {
+ case VG_PATH_DATATYPE_S_8: {
+ VGbyte **bdata = (VGbyte **)data;
+ for (i = start; i < end; ++i) {
+ *itr = (*bdata)[i];
+ ++itr;
+ }
+ *bdata += count;
+ }
+ break;
+ case VG_PATH_DATATYPE_S_16: {
+ VGshort **bdata = (VGshort **)data;
+ for (i = start; i < end; ++i) {
+ *itr = (*bdata)[i];
+ ++itr;
+ }
+ *bdata += count;
+ }
+ break;
+ case VG_PATH_DATATYPE_S_32: {
+ VGint **bdata = (VGint **)data;
+ for (i = start; i < end; ++i) {
+ *itr = (*bdata)[i];
+ ++itr;
+ }
+ *bdata += count;
+ }
+ break;
+ case VG_PATH_DATATYPE_F: {
+ VGfloat **fdata = (VGfloat **)data;
+ for (i = start; i < end; ++i) {
+ *itr = (*fdata)[i];
+ ++itr;
+ }
+ *fdata += count;
+ }
+ break;
+ default:
+ debug_assert(!"Unknown path datatype!");
+ }
+}
+
+
+void vg_float_to_datatype(VGPathDatatype datatype,
+ VGubyte *common_data,
+ const VGfloat *data,
+ VGint num_coords)
+{
+ VGint i;
+ switch(datatype) {
+ case VG_PATH_DATATYPE_S_8: {
+ for (i = 0; i < num_coords; ++i) {
+ common_data[i] = (VGubyte)data[i];
+ }
+ }
+ break;
+ case VG_PATH_DATATYPE_S_16: {
+ VGshort *buf = (VGshort*)common_data;
+ for (i = 0; i < num_coords; ++i) {
+ buf[i] = (VGshort)data[i];
+ }
+ }
+ break;
+ case VG_PATH_DATATYPE_S_32: {
+ VGint *buf = (VGint*)common_data;
+ for (i = 0; i < num_coords; ++i) {
+ buf[i] = (VGint)data[i];
+ }
+ }
+ break;
+ case VG_PATH_DATATYPE_F: {
+ memcpy(common_data, data, sizeof(VGfloat) * num_coords);
+ }
+ break;
+ default:
+ debug_assert(!"Unknown path datatype!");
+ }
+}
+
+static void coords_adjust_by_scale_bias(struct path *p,
+ void *pdata, VGint num_coords,
+ VGfloat scale, VGfloat bias,
+ VGPathDatatype datatype)
+{
+ VGfloat data[8];
+ void *coords = (VGfloat *)pdata;
+ VGubyte *common_data = (VGubyte *)pdata;
+ VGint size_dst = size_for_datatype(datatype);
+ VGint i;
+
+ for (i = 0; i < num_coords; ++i) {
+ data_at(&coords, p, 0, 1, data);
+ data[0] = data[0] * scale + bias;
+ vg_float_to_datatype(datatype, common_data, data, 1);
+ common_data += size_dst;
+ }
+}
+
+struct path * path_create(VGPathDatatype dt, VGfloat scale, VGfloat bias,
+ VGint segmentCapacityHint,
+ VGint coordCapacityHint,
+ VGbitfield capabilities)
+{
+ struct path *path = CALLOC_STRUCT(path);
+
+ vg_init_object(&path->base, vg_current_context(), VG_OBJECT_PATH);
+ path->caps = capabilities & VG_PATH_CAPABILITY_ALL;
+ vg_context_add_object(vg_current_context(), VG_OBJECT_PATH, path);
+
+ path->datatype = dt;
+ path->scale = scale;
+ path->bias = bias;
+
+ path->segments = array_create(size_for_datatype(VG_PATH_DATATYPE_S_8));
+ path->control_points = array_create(size_for_datatype(dt));
+
+ path->dirty = VG_TRUE;
+ path->dirty_stroke = VG_TRUE;
+
+ return path;
+}
+
+void path_destroy(struct path *p)
+{
+ vg_context_remove_object(vg_current_context(), VG_OBJECT_PATH, p);
+
+ array_destroy(p->segments);
+ array_destroy(p->control_points);
+ array_destroy(p->fill_polys.polygon_array.array);
+
+ if (p->stroked.path)
+ path_destroy(p->stroked.path);
+
+ free(p);
+}
+
+VGbitfield path_capabilities(struct path *p)
+{
+ return p->caps;
+}
+
+void path_set_capabilities(struct path *p, VGbitfield bf)
+{
+ p->caps = (bf & VG_PATH_CAPABILITY_ALL);
+}
+
+void path_append_data(struct path *p,
+ VGint numSegments,
+ const VGubyte * pathSegments,
+ const void * pathData)
+{
+ VGint old_segments = p->num_segments;
+ VGint num_new_coords = num_elements_for_segments(pathSegments, numSegments);
+ array_append_data(p->segments, pathSegments, numSegments);
+ array_append_data(p->control_points, pathData, num_new_coords);
+
+ p->num_segments += numSegments;
+ if (!floatsEqual(p->scale, 1.f) || !floatsEqual(p->bias, 0.f)) {
+ VGubyte *coords = (VGubyte*)p->control_points->data;
+ coords_adjust_by_scale_bias(p,
+ coords + old_segments * p->control_points->datatype_size,
+ num_new_coords,
+ p->scale, p->bias, p->datatype);
+ }
+ p->dirty = VG_TRUE;
+ p->dirty_stroke = VG_TRUE;
+}
+
+VGint path_num_segments(struct path *p)
+{
+ return p->num_segments;
+}
+
+static INLINE void map_if_relative(VGfloat ox, VGfloat oy,
+ VGboolean relative,
+ VGfloat *x, VGfloat *y)
+{
+ if (relative) {
+ if (x)
+ *x += ox;
+ if (y)
+ *y += oy;
+ }
+}
+
+static INLINE void close_polygon(struct polygon *current,
+ VGfloat sx, VGfloat sy,
+ VGfloat ox, VGfloat oy,
+ struct matrix *matrix)
+{
+ if (!floatsEqual(sx, ox) ||
+ !floatsEqual(sy, oy)) {
+ VGfloat x0 = sx;
+ VGfloat y0 = sy;
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ polygon_vertex_append(current, x0, y0);
+ }
+}
+
+static void convert_path(struct path *p,
+ VGPathDatatype to,
+ void *dst,
+ VGint num_coords)
+{
+ VGfloat data[8];
+ void *coords = (VGfloat *)p->control_points->data;
+ VGubyte *common_data = (VGubyte *)dst;
+ VGint size_dst = size_for_datatype(to);
+ VGint i;
+
+ for (i = 0; i < num_coords; ++i) {
+ data_at(&coords, p, 0, 1, data);
+ vg_float_to_datatype(to, common_data, data, 1);
+ common_data += size_dst;
+ }
+}
+
+
+static void polygon_array_calculate_bounds( struct polygon_array *polyarray )
+{
+ struct array *polys = polyarray->array;
+ VGfloat min_x, max_x;
+ VGfloat min_y, max_y;
+ VGfloat bounds[4];
+ unsigned i;
+
+ assert(polys);
+ assert(polys->num_elements);
+ polygon_bounding_rect((((struct polygon**)polys->data)[0]), bounds);
+ min_x = bounds[0];
+ min_y = bounds[1];
+ max_x = bounds[0] + bounds[2];
+ max_y = bounds[1] + bounds[3];
+ for (i = 1; i < polys->num_elements; ++i) {
+ struct polygon *p = (((struct polygon**)polys->data)[i]);
+ polygon_bounding_rect(p, bounds);
+ min_x = MIN2(min_x, bounds[0]);
+ min_y = MIN2(min_y, bounds[1]);
+ max_x = MAX2(max_x, bounds[0] + bounds[2]);
+ max_y = MAX2(max_y, bounds[1] + bounds[3]);
+ }
+
+ polyarray->min_x = min_x;
+ polyarray->min_y = min_y;
+ polyarray->max_x = max_x;
+ polyarray->max_y = max_y;
+}
+
+
+static struct polygon_array * path_get_fill_polygons(struct path *p, struct matrix *matrix)
+{
+ VGint i;
+ struct polygon *current = 0;
+ VGfloat sx, sy, px, py, ox, oy;
+ VGfloat x0, y0, x1, y1, x2, y2, x3, y3;
+ VGfloat data[8];
+ void *coords = (VGfloat *)p->control_points->data;
+ struct array *array;
+
+ if (p->fill_polys.polygon_array.array)
+ {
+ if (memcmp( &p->fill_polys.matrix,
+ matrix,
+ sizeof *matrix ) == 0 && p->dirty == VG_FALSE)
+ {
+ return &p->fill_polys.polygon_array;
+ }
+ else {
+ array_destroy( p->fill_polys.polygon_array.array );
+ p->fill_polys.polygon_array.array = NULL;
+ }
+ }
+
+ array = array_create(sizeof(struct array*));
+
+ sx = sy = px = py = ox = oy = 0.f;
+
+ current = polygon_create(32);
+
+ for (i = 0; i < p->num_segments; ++i) {
+ VGubyte segment = ((VGubyte*)(p->segments->data))[i];
+ VGint command = SEGMENT_COMMAND(segment);
+ VGboolean relative = SEGMENT_ABS_REL(segment);
+
+ switch(command) {
+ case VG_CLOSE_PATH:
+ close_polygon(current, sx, sy, ox, oy, matrix);
+ ox = sx;
+ oy = sy;
+ break;
+ case VG_MOVE_TO:
+ if (current && polygon_vertex_count(current) > 0) {
+ /* add polygon */
+ close_polygon(current, sx, sy, ox, oy, matrix);
+ array_append_data(array, &current, 1);
+ current = polygon_create(32);
+ }
+ data_at(&coords, p, 0, 2, data);
+ x0 = data[0];
+ y0 = data[1];
+ map_if_relative(ox, oy, relative, &x0, &y0);
+ sx = x0;
+ sy = y0;
+ ox = x0;
+ oy = y0;
+ px = x0;
+ py = y0;
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ polygon_vertex_append(current, x0, y0);
+ break;
+ case VG_LINE_TO:
+ data_at(&coords, p, 0, 2, data);
+ x0 = data[0];
+ y0 = data[1];
+ map_if_relative(ox, oy, relative, &x0, &y0);
+ ox = x0;
+ oy = y0;
+ px = x0;
+ py = y0;
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ polygon_vertex_append(current, x0, y0);
+ break;
+ case VG_HLINE_TO:
+ data_at(&coords, p, 0, 1, data);
+ x0 = data[0];
+ y0 = oy;
+ map_if_relative(ox, oy, relative, &x0, 0);
+ ox = x0;
+ px = x0;
+ py = y0;
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ polygon_vertex_append(current, x0, y0);
+ break;
+ case VG_VLINE_TO:
+ data_at(&coords, p, 0, 1, data);
+ x0 = ox;
+ y0 = data[0];
+ map_if_relative(ox, oy, relative, 0, &y0);
+ oy = y0;
+ px = x0;
+ py = y0;
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ polygon_vertex_append(current, x0, y0);
+ break;
+ case VG_CUBIC_TO: {
+ struct bezier bezier;
+ data_at(&coords, p, 0, 6, data);
+ x0 = ox;
+ y0 = oy;
+ x1 = data[0];
+ y1 = data[1];
+ x2 = data[2];
+ y2 = data[3];
+ x3 = data[4];
+ y3 = data[5];
+ map_if_relative(ox, oy, relative, &x1, &y1);
+ map_if_relative(ox, oy, relative, &x2, &y2);
+ map_if_relative(ox, oy, relative, &x3, &y3);
+ ox = x3;
+ oy = y3;
+ px = x2;
+ py = y2;
+ assert(matrix_is_affine(matrix));
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ matrix_map_point(matrix, x1, y1, &x1, &y1);
+ matrix_map_point(matrix, x2, y2, &x2, &y2);
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ bezier_init(&bezier, x0, y0, x1, y1,
+ x2, y2, x3, y3);
+ bezier_add_to_polygon(&bezier, current);
+ }
+ break;
+ case VG_QUAD_TO: {
+ struct bezier bezier;
+ data_at(&coords, p, 0, 4, data);
+ x0 = ox;
+ y0 = oy;
+ x1 = data[0];
+ y1 = data[1];
+ x3 = data[2];
+ y3 = data[3];
+ map_if_relative(ox, oy, relative, &x1, &y1);
+ map_if_relative(ox, oy, relative, &x3, &y3);
+ px = x1;
+ py = y1;
+ { /* form a cubic out of it */
+ x2 = (x3 + 2*x1) / 3.f;
+ y2 = (y3 + 2*y1) / 3.f;
+ x1 = (x0 + 2*x1) / 3.f;
+ y1 = (y0 + 2*y1) / 3.f;
+ }
+ ox = x3;
+ oy = y3;
+ assert(matrix_is_affine(matrix));
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ matrix_map_point(matrix, x1, y1, &x1, &y1);
+ matrix_map_point(matrix, x2, y2, &x2, &y2);
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ bezier_init(&bezier, x0, y0, x1, y1,
+ x2, y2, x3, y3);
+ bezier_add_to_polygon(&bezier, current);
+ }
+ break;
+ case VG_SQUAD_TO: {
+ struct bezier bezier;
+ data_at(&coords, p, 0, 2, data);
+ x0 = ox;
+ y0 = oy;
+ x1 = 2*ox-px;
+ y1 = 2*oy-py;
+ x3 = data[0];
+ y3 = data[1];
+ map_if_relative(ox, oy, relative, &x3, &y3);
+ px = x1;
+ py = y1;
+ { /* form a cubic out of it */
+ x2 = (x3 + 2*x1) / 3.f;
+ y2 = (y3 + 2*y1) / 3.f;
+ x1 = (x0 + 2*x1) / 3.f;
+ y1 = (y0 + 2*y1) / 3.f;
+ }
+ ox = x3;
+ oy = y3;
+ assert(matrix_is_affine(matrix));
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ matrix_map_point(matrix, x1, y1, &x1, &y1);
+ matrix_map_point(matrix, x2, y2, &x2, &y2);
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ bezier_init(&bezier, x0, y0, x1, y1,
+ x2, y2, x3, y3);
+ bezier_add_to_polygon(&bezier, current);
+ }
+ break;
+ case VG_SCUBIC_TO: {
+ struct bezier bezier;
+ data_at(&coords, p, 0, 4, data);
+ x0 = ox;
+ y0 = oy;
+ x1 = 2*ox-px;
+ y1 = 2*oy-py;
+ x2 = data[0];
+ y2 = data[1];
+ x3 = data[2];
+ y3 = data[3];
+ map_if_relative(ox, oy, relative, &x2, &y2);
+ map_if_relative(ox, oy, relative, &x3, &y3);
+ ox = x3;
+ oy = y3;
+ px = x2;
+ py = y2;
+ assert(matrix_is_affine(matrix));
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ matrix_map_point(matrix, x1, y1, &x1, &y1);
+ matrix_map_point(matrix, x2, y2, &x2, &y2);
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ bezier_init(&bezier, x0, y0, x1, y1,
+ x2, y2, x3, y3);
+ bezier_add_to_polygon(&bezier, current);
+ }
+ break;
+ case VG_SCCWARC_TO:
+ case VG_SCWARC_TO:
+ case VG_LCCWARC_TO:
+ case VG_LCWARC_TO: {
+ VGfloat rh, rv, rot;
+ struct arc arc;
+
+ data_at(&coords, p, 0, 5, data);
+ x0 = ox;
+ y0 = oy;
+ rh = data[0];
+ rv = data[1];
+ rot = data[2];
+ x1 = data[3];
+ y1 = data[4];
+ map_if_relative(ox, oy, relative, &x1, &y1);
+#if 0
+ debug_printf("------- ARC (%f, %f), (%f, %f) %f, %f, %f\n",
+ x0, y0, x1, y1, rh, rv, rot);
+#endif
+ arc_init(&arc, command, x0, y0, x1, y1,
+ rh, rv, rot);
+ arc_add_to_polygon(&arc, current,
+ matrix);
+ ox = x1;
+ oy = y1;
+ px = x1;
+ py = y1;
+ }
+ break;
+ default:
+ abort();
+ assert(!"Unknown segment!");
+ }
+ }
+ if (current) {
+ if (polygon_vertex_count(current) > 0) {
+ close_polygon(current, sx, sy, ox, oy, matrix);
+ array_append_data(array, &current, 1);
+ } else
+ polygon_destroy(current);
+ }
+
+ p->fill_polys.polygon_array.array = array;
+ p->fill_polys.matrix = *matrix;
+
+ polygon_array_calculate_bounds( &p->fill_polys.polygon_array );
+
+ p->dirty = VG_FALSE;
+
+ return &p->fill_polys.polygon_array;
+}
+
+VGbyte path_datatype_size(struct path *p)
+{
+ return size_for_datatype(p->datatype);
+}
+
+VGPathDatatype path_datatype(struct path *p)
+{
+ return p->datatype;
+}
+
+VGfloat path_scale(struct path *p)
+{
+ return p->scale;
+}
+
+VGfloat path_bias(struct path *p)
+{
+ return p->bias;
+}
+
+VGint path_num_coords(struct path *p)
+{
+ return num_elements_for_segments((VGubyte*)p->segments->data,
+ p->num_segments);
+}
+
+void path_modify_coords(struct path *p,
+ VGint startIndex,
+ VGint numSegments,
+ const void * pathData)
+{
+ VGubyte *segments = (VGubyte*)(p->segments->data);
+ VGint count = num_elements_for_segments(&segments[startIndex], numSegments);
+ VGint start_cp = num_elements_for_segments(segments, startIndex);
+
+ array_change_data(p->control_points, pathData, start_cp, count);
+ coords_adjust_by_scale_bias(p,
+ ((VGubyte*)p->control_points->data) +
+ (startIndex * p->control_points->datatype_size),
+ path_num_coords(p),
+ p->scale, p->bias, p->datatype);
+ p->dirty = VG_TRUE;
+ p->dirty_stroke = VG_TRUE;
+}
+
+void path_for_each_segment(struct path *path,
+ path_for_each_cb cb,
+ void *user_data)
+{
+ VGint i;
+ struct path_for_each_data p;
+ VGfloat data[8];
+ void *coords = (VGfloat *)path->control_points->data;
+
+ p.coords = data;
+ p.sx = p.sy = p.px = p.py = p.ox = p.oy = 0.f;
+ p.user_data = user_data;
+
+ for (i = 0; i < path->num_segments; ++i) {
+ VGint command;
+ VGboolean relative;
+
+ p.segment = ((VGubyte*)(path->segments->data))[i];
+ command = SEGMENT_COMMAND(p.segment);
+ relative = SEGMENT_ABS_REL(p.segment);
+
+ switch(command) {
+ case VG_CLOSE_PATH:
+ cb(path, &p);
+ break;
+ case VG_MOVE_TO:
+ data_at(&coords, path, 0, 2, data);
+ map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]);
+ cb(path, &p);
+ p.sx = data[0];
+ p.sy = data[1];
+ p.ox = data[0];
+ p.oy = data[1];
+ p.px = data[0];
+ p.py = data[1];
+ break;
+ case VG_LINE_TO:
+ data_at(&coords, path, 0, 2, data);
+ map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]);
+ cb(path, &p);
+ p.ox = data[0];
+ p.oy = data[1];
+ p.px = data[0];
+ p.py = data[1];
+ break;
+ case VG_HLINE_TO:
+ data_at(&coords, path, 0, 1, data);
+ map_if_relative(p.ox, p.oy, relative, &data[0], 0);
+ p.segment = VG_LINE_TO;
+ data[1] = p.oy;
+ cb(path, &p);
+ p.ox = data[0];
+ p.oy = data[1];
+ p.px = data[0];
+ p.py = data[1];
+ break;
+ case VG_VLINE_TO:
+ data_at(&coords, path, 0, 1, data);
+ map_if_relative(p.ox, p.oy, relative, 0, &data[0]);
+ p.segment = VG_LINE_TO;
+ data[1] = data[0];
+ data[0] = p.ox;
+ cb(path, &p);
+ p.ox = data[0];
+ p.oy = data[1];
+ p.px = data[0];
+ p.py = data[1];
+ break;
+ case VG_CUBIC_TO: {
+ data_at(&coords, path, 0, 6, data);
+ map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]);
+ map_if_relative(p.ox, p.oy, relative, &data[2], &data[3]);
+ map_if_relative(p.ox, p.oy, relative, &data[4], &data[5]);
+ cb(path, &p);
+ p.px = data[2];
+ p.py = data[3];
+ p.ox = data[4];
+ p.oy = data[5];
+ }
+ break;
+ case VG_QUAD_TO: {
+ data_at(&coords, path, 0, 4, data);
+ map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]);
+ map_if_relative(p.ox, p.oy, relative, &data[2], &data[3]);
+ cb(path, &p);
+ p.px = data[0];
+ p.py = data[1];
+ p.ox = data[2];
+ p.oy = data[3];
+ }
+ break;
+ case VG_SQUAD_TO: {
+ data_at(&coords, path, 0, 2, data);
+ map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]);
+ cb(path, &p);
+ p.px = 2*p.ox-p.px;
+ p.py = 2*p.oy-p.py;
+ p.ox = data[2];
+ p.oy = data[3];
+ }
+ break;
+ case VG_SCUBIC_TO: {
+ data_at(&coords, path, 0, 4, data);
+ map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]);
+ map_if_relative(p.ox, p.oy, relative, &data[2], &data[3]);
+ cb(path, &p);
+ p.px = data[0];
+ p.py = data[1];
+ p.ox = data[2];
+ p.oy = data[3];
+ }
+ break;
+ case VG_SCCWARC_TO:
+ case VG_SCWARC_TO:
+ case VG_LCCWARC_TO:
+ case VG_LCWARC_TO: {
+ data_at(&coords, path, 0, 5, data);
+ map_if_relative(p.ox, p.oy, relative, &data[3], &data[4]);
+#if 0
+ debug_printf("------- ARC (%f, %f), (%f, %f) %f, %f, %f\n",
+ p.ox, p.oy, data[3], data[4], data[0], data[1], data[2]);
+#endif
+ cb(path, &p);
+ p.ox = data[3];
+ p.oy = data[4];
+ p.px = data[3];
+ p.py = data[4];
+ }
+ break;
+ default:
+ abort();
+ assert(!"Unknown segment!");
+ }
+ }
+}
+
+struct transform_data {
+ struct array *segments;
+ struct array *coords;
+
+ struct matrix *matrix;
+
+ VGPathDatatype datatype;
+};
+
+static VGboolean transform_cb(struct path *p,
+ struct path_for_each_data *pd)
+{
+ struct transform_data *td = (struct transform_data *)pd->user_data;
+ VGint num_coords = num_elements_for_segments(&pd->segment, 1);
+ VGubyte segment = SEGMENT_COMMAND(pd->segment);/* abs bit is 0 */
+ VGfloat data[8];
+ VGubyte common_data[sizeof(VGfloat)*8];
+
+ memcpy(data, pd->coords, sizeof(VGfloat) * num_coords);
+
+ switch(segment) {
+ case VG_CLOSE_PATH:
+ break;
+ case VG_MOVE_TO:
+ matrix_map_point(td->matrix,
+ data[0], data[1], &data[0], &data[1]);
+ break;
+ case VG_LINE_TO:
+ matrix_map_point(td->matrix,
+ data[0], data[1], &data[0], &data[1]);
+ break;
+ case VG_HLINE_TO:
+ case VG_VLINE_TO:
+ assert(0);
+ break;
+ case VG_QUAD_TO:
+ matrix_map_point(td->matrix,
+ data[0], data[1], &data[0], &data[1]);
+ matrix_map_point(td->matrix,
+ data[2], data[3], &data[2], &data[3]);
+ break;
+ case VG_CUBIC_TO:
+ matrix_map_point(td->matrix,
+ data[0], data[1], &data[0], &data[1]);
+ matrix_map_point(td->matrix,
+ data[2], data[3], &data[2], &data[3]);
+ matrix_map_point(td->matrix,
+ data[4], data[5], &data[4], &data[5]);
+ break;
+ case VG_SQUAD_TO:
+ matrix_map_point(td->matrix,
+ data[0], data[1], &data[0], &data[1]);
+ break;
+ case VG_SCUBIC_TO:
+ matrix_map_point(td->matrix,
+ data[0], data[1], &data[0], &data[1]);
+ matrix_map_point(td->matrix,
+ data[2], data[3], &data[2], &data[3]);
+ break;
+ case VG_SCCWARC_TO:
+ case VG_SCWARC_TO:
+ case VG_LCCWARC_TO:
+ case VG_LCWARC_TO: {
+ struct arc arc;
+ struct path *path = path_create(td->datatype,
+ 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL);
+ arc_init(&arc, segment,
+ pd->ox, pd->oy, data[3], data[4],
+ data[0], data[1], data[2]);
+
+ arc_to_path(&arc, path, td->matrix);
+
+ num_coords = path_num_coords(path);
+
+ array_append_data(td->segments, path->segments->data,
+ path->num_segments);
+ array_append_data(td->coords, path->control_points->data,
+ num_coords);
+ path_destroy(path);
+
+ return VG_TRUE;
+ }
+ break;
+ default:
+ break;
+ }
+
+ vg_float_to_datatype(td->datatype, common_data, data, num_coords);
+
+ array_append_data(td->segments, &segment, 1);
+ array_append_data(td->coords, common_data, num_coords);
+ return VG_TRUE;
+}
+
+void path_transform(struct path *dst, struct path *src)
+{
+ struct transform_data data;
+ struct vg_context *ctx = dst->base.ctx;
+
+ data.segments = dst->segments;
+ data.coords = dst->control_points;
+ data.matrix = &ctx->state.vg.path_user_to_surface_matrix;
+ data.datatype = dst->datatype;
+
+ path_for_each_segment(src, transform_cb, (void*)&data);
+
+ dst->num_segments = dst->segments->num_elements;
+ dst->dirty = VG_TRUE;
+ dst->dirty_stroke = VG_TRUE;
+}
+
+void path_append_path(struct path *dst,
+ struct path *src)
+{
+ VGint num_coords = path_num_coords(src);
+ void *dst_data = malloc(size_for_datatype(dst->datatype) * num_coords);
+ array_append_data(dst->segments,
+ src->segments->data,
+ src->num_segments);
+ convert_path(src, dst->datatype,
+ dst_data, num_coords);
+ array_append_data(dst->control_points,
+ dst_data,
+ num_coords);
+ free(dst_data);
+
+ dst->num_segments += src->num_segments;
+ dst->dirty = VG_TRUE;
+ dst->dirty_stroke = VG_TRUE;
+}
+
+static INLINE VGboolean is_segment_arc(VGubyte segment)
+{
+ VGubyte scommand = SEGMENT_COMMAND(segment);
+ return (scommand == VG_SCCWARC_TO ||
+ scommand == VG_SCWARC_TO ||
+ scommand == VG_LCCWARC_TO ||
+ scommand == VG_LCWARC_TO);
+}
+
+struct path_iter_data {
+ struct path *path;
+ VGubyte segment;
+ void *coords;
+ VGfloat px, py, ox, oy, sx, sy;
+};
+static INLINE VGubyte normalize_coords(struct path_iter_data *pd,
+ VGint *num_coords,
+ VGfloat *data)
+{
+ VGint command = SEGMENT_COMMAND(pd->segment);
+ VGboolean relative = SEGMENT_ABS_REL(pd->segment);
+
+ switch(command) {
+ case VG_CLOSE_PATH:
+ *num_coords = 0;
+ pd->ox = pd->sx;
+ pd->oy = pd->sy;
+ return VG_CLOSE_PATH;
+ break;
+ case VG_MOVE_TO:
+ data_at(&pd->coords, pd->path, 0, 2, data);
+ map_if_relative(pd->ox, pd->oy, relative, &data[0], &data[1]);
+ pd->sx = data[0];
+ pd->sy = data[1];
+ pd->ox = data[0];
+ pd->oy = data[1];
+ pd->px = data[0];
+ pd->py = data[1];
+ *num_coords = 2;
+ return VG_MOVE_TO_ABS;
+ break;
+ case VG_LINE_TO:
+ data_at(&pd->coords, pd->path, 0, 2, data);
+ map_if_relative(pd->ox, pd->oy, relative, &data[0], &data[1]);
+ pd->ox = data[0];
+ pd->oy = data[1];
+ pd->px = data[0];
+ pd->py = data[1];
+ *num_coords = 2;
+ return VG_LINE_TO_ABS;
+ break;
+ case VG_HLINE_TO:
+ data_at(&pd->coords, pd->path, 0, 1, data);
+ map_if_relative(pd->ox, pd->oy, relative, &data[0], 0);
+ data[1] = pd->oy;
+ pd->ox = data[0];
+ pd->oy = data[1];
+ pd->px = data[0];
+ pd->py = data[1];
+ *num_coords = 2;
+ return VG_LINE_TO_ABS;
+ break;
+ case VG_VLINE_TO:
+ data_at(&pd->coords, pd->path, 0, 1, data);
+ map_if_relative(pd->ox, pd->oy, relative, 0, &data[0]);
+ data[1] = data[0];
+ data[0] = pd->ox;
+ pd->ox = data[0];
+ pd->oy = data[1];
+ pd->px = data[0];
+ pd->py = data[1];
+ *num_coords = 2;
+ return VG_LINE_TO_ABS;
+ break;
+ case VG_CUBIC_TO: {
+ data_at(&pd->coords, pd->path, 0, 6, data);
+ map_if_relative(pd->ox, pd->oy, relative, &data[0], &data[1]);
+ map_if_relative(pd->ox, pd->oy, relative, &data[2], &data[3]);
+ map_if_relative(pd->ox, pd->oy, relative, &data[4], &data[5]);
+ pd->px = data[2];
+ pd->py = data[3];
+ pd->ox = data[4];
+ pd->oy = data[5];
+ *num_coords = 6;
+ return VG_CUBIC_TO_ABS;
+ }
+ break;
+ case VG_QUAD_TO: {
+ VGfloat x0, y0, x1, y1, x2, y2, x3, y3;
+ data_at(&pd->coords, pd->path, 0, 4, data);
+ x0 = pd->ox;
+ y0 = pd->oy;
+ x1 = data[0];
+ y1 = data[1];
+ x3 = data[2];
+ y3 = data[3];
+ map_if_relative(pd->ox, pd->oy, relative, &x1, &y1);
+ map_if_relative(pd->ox, pd->oy, relative, &x3, &y3);
+ pd->px = x1;
+ pd->py = y1;
+ { /* form a cubic out of it */
+ x2 = (x3 + 2*x1) / 3.f;
+ y2 = (y3 + 2*y1) / 3.f;
+ x1 = (x0 + 2*x1) / 3.f;
+ y1 = (y0 + 2*y1) / 3.f;
+ }
+ pd->ox = x3;
+ pd->oy = y3;
+ data[0] = x1;
+ data[1] = y1;
+ data[2] = x2;
+ data[3] = y2;
+ data[4] = x3;
+ data[5] = y3;
+ *num_coords = 6;
+ return VG_CUBIC_TO_ABS;
+ }
+ break;
+ case VG_SQUAD_TO: {
+ VGfloat x0, y0, x1, y1, x2, y2, x3, y3;
+ data_at(&pd->coords, pd->path, 0, 2, data);
+ x0 = pd->ox;
+ y0 = pd->oy;
+ x1 = 2 * pd->ox - pd->px;
+ y1 = 2 * pd->oy - pd->py;
+ x3 = data[0];
+ y3 = data[1];
+ map_if_relative(pd->ox, pd->oy, relative, &x3, &y3);
+ pd->px = x1;
+ pd->py = y1;
+ { /* form a cubic out of it */
+ x2 = (x3 + 2*x1) / 3.f;
+ y2 = (y3 + 2*y1) / 3.f;
+ x1 = (x0 + 2*x1) / 3.f;
+ y1 = (y0 + 2*y1) / 3.f;
+ }
+ pd->ox = x3;
+ pd->oy = y3;
+ data[0] = x1;
+ data[1] = y1;
+ data[2] = x2;
+ data[3] = y2;
+ data[4] = x3;
+ data[5] = y3;
+ *num_coords = 6;
+ return VG_CUBIC_TO_ABS;
+ }
+ break;
+ case VG_SCUBIC_TO: {
+ VGfloat x0, y0, x1, y1, x2, y2, x3, y3;
+ data_at(&pd->coords, pd->path, 0, 4, data);
+ x0 = pd->ox;
+ y0 = pd->oy;
+ x1 = 2*pd->ox-pd->px;
+ y1 = 2*pd->oy-pd->py;
+ x2 = data[0];
+ y2 = data[1];
+ x3 = data[2];
+ y3 = data[3];
+ map_if_relative(pd->ox, pd->oy, relative, &x2, &y2);
+ map_if_relative(pd->ox, pd->oy, relative, &x3, &y3);
+ pd->ox = x3;
+ pd->oy = y3;
+ pd->px = x2;
+ pd->py = y2;
+ data[0] = x1;
+ data[1] = y1;
+ data[2] = x2;
+ data[3] = y2;
+ data[4] = x3;
+ data[5] = y3;
+ *num_coords = 6;
+ return VG_CUBIC_TO_ABS;
+ }
+ break;
+ case VG_SCCWARC_TO:
+ case VG_SCWARC_TO:
+ case VG_LCCWARC_TO:
+ case VG_LCWARC_TO: {
+ data_at(&pd->coords, pd->path, 0, 5, data);
+ map_if_relative(pd->ox, pd->oy, relative, &data[3], &data[4]);
+ pd->ox = data[3];
+ pd->oy = data[4];
+ pd->px = data[3];
+ pd->py = data[4];
+ *num_coords = 5;
+ return command | VG_ABSOLUTE;
+ }
+ break;
+ default:
+ abort();
+ assert(!"Unknown segment!");
+ }
+}
+
+static void linearly_interpolate(VGfloat *result,
+ const VGfloat *start,
+ const VGfloat *end,
+ VGfloat amount,
+ VGint number)
+{
+ VGint i;
+ for (i = 0; i < number; ++i) {
+ result[i] = start[i] + (end[i] - start[i]) * amount;
+ }
+}
+
+VGboolean path_interpolate(struct path *dst,
+ struct path *start, struct path *end,
+ VGfloat amount)
+{
+ /* temporary path that we can discard if it will turn
+ * out that start is not compatible with end */
+ struct path *res_path = path_create(dst->datatype,
+ 1.0, 0.0,
+ 0, 0, dst->caps);
+ VGint i;
+ VGfloat start_coords[8];
+ VGfloat end_coords[8];
+ VGfloat results[8];
+ VGubyte common_data[sizeof(VGfloat)*8];
+ struct path_iter_data start_iter, end_iter;
+
+ memset(&start_iter, 0, sizeof(struct path_iter_data));
+ memset(&end_iter, 0, sizeof(struct path_iter_data));
+
+ start_iter.path = start;
+ start_iter.coords = start->control_points->data;
+ end_iter.path = end;
+ end_iter.coords = end->control_points->data;
+
+ for (i = 0; i < start->num_segments; ++i) {
+ VGubyte segment;
+ VGubyte ssegment, esegment;
+ VGint snum_coords, enum_coords;
+ start_iter.segment = ((VGubyte*)(start->segments->data))[i];
+ end_iter.segment = ((VGubyte*)(end->segments->data))[i];
+
+ ssegment = normalize_coords(&start_iter, &snum_coords,
+ start_coords);
+ esegment = normalize_coords(&end_iter, &enum_coords,
+ end_coords);
+
+ if (is_segment_arc(ssegment)) {
+ if (!is_segment_arc(esegment)) {
+ path_destroy(res_path);
+ return VG_FALSE;
+ }
+ if (amount > 0.5)
+ segment = esegment;
+ else
+ segment = ssegment;
+ } else if (is_segment_arc(esegment)) {
+ path_destroy(res_path);
+ return VG_FALSE;
+ }
+ else if (ssegment != esegment) {
+ path_destroy(res_path);
+ return VG_FALSE;
+ }
+ else
+ segment = ssegment;
+
+ linearly_interpolate(results, start_coords, end_coords,
+ amount, snum_coords);
+ vg_float_to_datatype(dst->datatype, common_data, results, snum_coords);
+ path_append_data(res_path, 1, &segment, common_data);
+ }
+
+ path_append_path(dst, res_path);
+ path_destroy(res_path);
+
+ dst->dirty = VG_TRUE;
+ dst->dirty_stroke = VG_TRUE;
+
+ return VG_TRUE;
+}
+
+void path_clear(struct path *p, VGbitfield capabilities)
+{
+ path_set_capabilities(p, capabilities);
+ array_destroy(p->segments);
+ array_destroy(p->control_points);
+ p->segments = array_create(size_for_datatype(VG_PATH_DATATYPE_S_8));
+ p->control_points = array_create(size_for_datatype(p->datatype));
+ p->num_segments = 0;
+ p->dirty = VG_TRUE;
+ p->dirty_stroke = VG_TRUE;
+}
+
+struct path * path_create_stroke(struct path *p,
+ struct matrix *matrix)
+{
+ VGint i;
+ VGfloat sx, sy, px, py, ox, oy;
+ VGfloat x0, y0, x1, y1, x2, y2, x3, y3;
+ VGfloat data[8];
+ void *coords = (VGfloat *)p->control_points->data;
+ int dashed = (p->base.ctx->state.vg.stroke.dash_pattern_num ? 1 : 0);
+ struct dash_stroker stroker;
+ struct vg_state *vg_state = &p->base.ctx->state.vg;
+
+ if (p->stroked.path)
+ {
+ /* ### compare the dash patterns to see if we can cache them.
+ * for now we simply always bail out if the path is dashed.
+ */
+ if (memcmp( &p->stroked.matrix,
+ matrix,
+ sizeof *matrix ) == 0 &&
+ !dashed && !p->dirty_stroke &&
+ floatsEqual(p->stroked.stroke_width, vg_state->stroke.line_width.f) &&
+ floatsEqual(p->stroked.miter_limit, vg_state->stroke.miter_limit.f) &&
+ p->stroked.cap_style == vg_state->stroke.cap_style &&
+ p->stroked.join_style == vg_state->stroke.join_style)
+ {
+ return p->stroked.path;
+ }
+ else {
+ path_destroy( p->stroked.path );
+ p->stroked.path = NULL;
+ }
+ }
+
+
+ sx = sy = px = py = ox = oy = 0.f;
+
+ if (dashed)
+ dash_stroker_init((struct stroker *)&stroker, vg_state);
+ else
+ stroker_init((struct stroker *)&stroker, vg_state);
+
+ stroker_begin((struct stroker *)&stroker);
+
+ for (i = 0; i < p->num_segments; ++i) {
+ VGubyte segment = ((VGubyte*)(p->segments->data))[i];
+ VGint command = SEGMENT_COMMAND(segment);
+ VGboolean relative = SEGMENT_ABS_REL(segment);
+
+ switch(command) {
+ case VG_CLOSE_PATH: {
+ VGfloat x0 = sx;
+ VGfloat y0 = sy;
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ stroker_line_to((struct stroker *)&stroker, x0, y0);
+ }
+ break;
+ case VG_MOVE_TO:
+ data_at(&coords, p, 0, 2, data);
+ x0 = data[0];
+ y0 = data[1];
+ map_if_relative(ox, oy, relative, &x0, &y0);
+ sx = x0;
+ sy = y0;
+ ox = x0;
+ oy = y0;
+ px = x0;
+ py = y0;
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ stroker_move_to((struct stroker *)&stroker, x0, y0);
+ break;
+ case VG_LINE_TO:
+ data_at(&coords, p, 0, 2, data);
+ x0 = data[0];
+ y0 = data[1];
+ map_if_relative(ox, oy, relative, &x0, &y0);
+ ox = x0;
+ oy = y0;
+ px = x0;
+ py = y0;
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ stroker_line_to((struct stroker *)&stroker, x0, y0);
+ break;
+ case VG_HLINE_TO:
+ data_at(&coords, p, 0, 1, data);
+ x0 = data[0];
+ y0 = oy;
+ map_if_relative(ox, oy, relative, &x0, 0);
+ ox = x0;
+ px = x0;
+ py = y0;
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ stroker_line_to((struct stroker *)&stroker, x0, y0);
+ break;
+ case VG_VLINE_TO:
+ data_at(&coords, p, 0, 1, data);
+ x0 = ox;
+ y0 = data[0];
+ map_if_relative(ox, oy, relative, 0, &y0);
+ oy = y0;
+ px = x0;
+ py = y0;
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ stroker_line_to((struct stroker *)&stroker, x0, y0);
+ break;
+ case VG_CUBIC_TO: {
+ data_at(&coords, p, 0, 6, data);
+ x0 = ox;
+ y0 = oy;
+ x1 = data[0];
+ y1 = data[1];
+ x2 = data[2];
+ y2 = data[3];
+ x3 = data[4];
+ y3 = data[5];
+ map_if_relative(ox, oy, relative, &x1, &y1);
+ map_if_relative(ox, oy, relative, &x2, &y2);
+ map_if_relative(ox, oy, relative, &x3, &y3);
+ if (floatsEqual(x1, ox) && floatsEqual(y1, oy) &&
+ floatsEqual(x1, x2) && floatsEqual(y1, y2) &&
+ floatsEqual(x2, x3) && floatsEqual(y2, y3)) {
+ /*ignore the empty segment */
+ continue;
+ } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) {
+ /* if dup vertex, emit a line */
+ ox = x3;
+ oy = y3;
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ stroker_line_to((struct stroker *)&stroker, x3, y3);
+ continue;
+ }
+ ox = x3;
+ oy = y3;
+ px = x2;
+ py = y2;
+ assert(matrix_is_affine(matrix));
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ matrix_map_point(matrix, x1, y1, &x1, &y1);
+ matrix_map_point(matrix, x2, y2, &x2, &y2);
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3);
+ }
+ break;
+ case VG_QUAD_TO: {
+ data_at(&coords, p, 0, 4, data);
+ x0 = ox;
+ y0 = oy;
+ x1 = data[0];
+ y1 = data[1];
+ x3 = data[2];
+ y3 = data[3];
+ map_if_relative(ox, oy, relative, &x1, &y1);
+ map_if_relative(ox, oy, relative, &x3, &y3);
+ px = x1;
+ py = y1;
+ { /* form a cubic out of it */
+ x2 = (x3 + 2*x1) / 3.f;
+ y2 = (y3 + 2*y1) / 3.f;
+ x1 = (x0 + 2*x1) / 3.f;
+ y1 = (y0 + 2*y1) / 3.f;
+ }
+ if (floatsEqual(x1, ox) && floatsEqual(y1, oy) &&
+ floatsEqual(x1, x2) && floatsEqual(y1, y2) &&
+ floatsEqual(x2, x3) && floatsEqual(y2, y3)) {
+ /*ignore the empty segment */
+ continue;
+ } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) {
+ /* if dup vertex, emit a line */
+ ox = x3;
+ oy = y3;
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ stroker_line_to((struct stroker *)&stroker, x3, y3);
+ continue;
+ }
+ ox = x3;
+ oy = y3;
+ assert(matrix_is_affine(matrix));
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ matrix_map_point(matrix, x1, y1, &x1, &y1);
+ matrix_map_point(matrix, x2, y2, &x2, &y2);
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3);
+ }
+ break;
+ case VG_SQUAD_TO: {
+ data_at(&coords, p, 0, 2, data);
+ x0 = ox;
+ y0 = oy;
+ x1 = 2*ox-px;
+ y1 = 2*oy-py;
+ x3 = data[0];
+ y3 = data[1];
+ map_if_relative(ox, oy, relative, &x3, &y3);
+ px = x1;
+ py = y1;
+ { /* form a cubic out of it */
+ x2 = (x3 + 2*x1) / 3.f;
+ y2 = (y3 + 2*y1) / 3.f;
+ x1 = (x0 + 2*x1) / 3.f;
+ y1 = (y0 + 2*y1) / 3.f;
+ }
+ if (floatsEqual(x1, ox) && floatsEqual(y1, oy) &&
+ floatsEqual(x1, x2) && floatsEqual(y1, y2) &&
+ floatsEqual(x2, x3) && floatsEqual(y2, y3)) {
+ /*ignore the empty segment */
+ continue;
+ } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) {
+ /* if dup vertex, emit a line */
+ ox = x3;
+ oy = y3;
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ stroker_line_to((struct stroker *)&stroker, x3, y3);
+ continue;
+ }
+ ox = x3;
+ oy = y3;
+ assert(matrix_is_affine(matrix));
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ matrix_map_point(matrix, x1, y1, &x1, &y1);
+ matrix_map_point(matrix, x2, y2, &x2, &y2);
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3);
+ }
+ break;
+ case VG_SCUBIC_TO: {
+ data_at(&coords, p, 0, 4, data);
+ x0 = ox;
+ y0 = oy;
+ x1 = 2*ox-px;
+ y1 = 2*oy-py;
+ x2 = data[0];
+ y2 = data[1];
+ x3 = data[2];
+ y3 = data[3];
+ map_if_relative(ox, oy, relative, &x2, &y2);
+ map_if_relative(ox, oy, relative, &x3, &y3);
+ if (floatsEqual(x1, ox) && floatsEqual(y1, oy) &&
+ floatsEqual(x1, x2) && floatsEqual(y1, y2) &&
+ floatsEqual(x2, x3) && floatsEqual(y2, y3)) {
+ /*ignore the empty segment */
+ continue;
+ } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) {
+ /* if dup vertex, emit a line */
+ ox = x3;
+ oy = y3;
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ stroker_line_to((struct stroker *)&stroker, x3, y3);
+ continue;
+ }
+ ox = x3;
+ oy = y3;
+ px = x2;
+ py = y2;
+ assert(matrix_is_affine(matrix));
+ matrix_map_point(matrix, x0, y0, &x0, &y0);
+ matrix_map_point(matrix, x1, y1, &x1, &y1);
+ matrix_map_point(matrix, x2, y2, &x2, &y2);
+ matrix_map_point(matrix, x3, y3, &x3, &y3);
+ stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3);
+ }
+ break;
+ case VG_SCCWARC_TO:
+ case VG_SCWARC_TO:
+ case VG_LCCWARC_TO:
+ case VG_LCWARC_TO: {
+ VGfloat rh, rv, rot;
+ struct arc arc;
+
+ data_at(&coords, p, 0, 5, data);
+ x0 = ox;
+ y0 = oy;
+ rh = data[0];
+ rv = data[1];
+ rot = data[2];
+ x1 = data[3];
+ y1 = data[4];
+ map_if_relative(ox, oy, relative, &x1, &y1);
+ if (floatsEqual(x1, ox) && floatsEqual(y1, oy)) {
+ /* if dup vertex, emit a line */
+ ox = x1;
+ oy = y1;
+ matrix_map_point(matrix, x1, y1, &x1, &y1);
+ stroker_line_to((struct stroker *)&stroker, x1, y1);
+ continue;
+ }
+ arc_init(&arc, command, x0, y0, x1, y1,
+ rh, rv, rot);
+ arc_stroke_cb(&arc, (struct stroker *)&stroker,
+ matrix);
+ ox = x1;
+ oy = y1;
+ px = x1;
+ py = y1;
+ }
+ break;
+ default:
+ abort();
+ assert(!"Unknown segment!");
+ }
+ }
+
+ stroker_end((struct stroker *)&stroker);
+
+ if (dashed)
+ dash_stroker_cleanup((struct dash_stroker *)&stroker);
+ else
+ stroker_cleanup((struct stroker *)&stroker);
+
+ p->stroked.path = stroker.base.path;
+ p->stroked.matrix = *matrix;
+ p->dirty_stroke = VG_FALSE;
+ p->stroked.stroke_width = vg_state->stroke.line_width.f;
+ p->stroked.miter_limit = vg_state->stroke.miter_limit.f;
+ p->stroked.cap_style = vg_state->stroke.cap_style;
+ p->stroked.join_style = vg_state->stroke.join_style;
+
+ return stroker.base.path;
+}
+
+void path_render(struct path *p, VGbitfield paintModes)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct matrix *mat = &ctx->state.vg.path_user_to_surface_matrix;
+
+ vg_validate_state(ctx);
+
+ shader_set_drawing_image(ctx->shader, VG_FALSE);
+ shader_set_image(ctx->shader, 0);
+#if 0
+ fprintf(stderr, "Matrix(11=%f 12=%f 13=%f 21=%f 22=%f 23=%f 31=%f 32=%f 33=%f)\n",
+ mat->m[0], mat->m[1], mat->m[2],
+ mat->m[3], mat->m[4], mat->m[5],
+ mat->m[6], mat->m[7], mat->m[8]);
+#endif
+ if (paintModes & VG_FILL_PATH) {
+ /* First the fill */
+ shader_set_paint(ctx->shader, ctx->state.vg.fill_paint);
+ shader_bind(ctx->shader);
+ path_fill(p, mat);
+ }
+
+ if (paintModes & VG_STROKE_PATH){
+ /* 8.7.5: "line width less than or equal to 0 prevents stroking from
+ * taking place."*/
+ if (ctx->state.vg.stroke.line_width.f <= 0)
+ return;
+ shader_set_paint(ctx->shader, ctx->state.vg.stroke_paint);
+ shader_bind(ctx->shader);
+ path_stroke(p);
+ }
+}
+
+void path_fill(struct path *p, struct matrix *mat)
+{
+ struct vg_context *ctx = vg_current_context();
+ {
+ struct polygon_array *polygon_array = path_get_fill_polygons(p, mat);
+ struct array *polys = polygon_array->array;
+
+ if (!polygon_array || !polys || !polys->num_elements) {
+ return;
+ }
+ polygon_array_fill(polygon_array, ctx);
+ }
+}
+
+void path_stroke(struct path *p)
+{
+ struct vg_context *ctx = vg_current_context();
+ struct matrix *mat = &ctx->state.vg.path_user_to_surface_matrix;
+ VGFillRule old_fill = ctx->state.vg.fill_rule;
+ struct matrix identity;
+ struct path *stroke;
+
+ matrix_load_identity(&identity);
+ stroke = path_create_stroke(p, &identity);
+ if (stroke && !path_is_empty(stroke)) {
+ ctx->state.vg.fill_rule = VG_NON_ZERO;
+
+ path_fill(stroke, mat);
+
+ ctx->state.vg.fill_rule = old_fill;
+ }
+}
+
+void path_move_to(struct path *p, float x, float y)
+{
+ VGubyte segment = VG_MOVE_TO_ABS;
+ VGubyte common_data[sizeof(VGfloat) * 2];
+ VGfloat data[2] = {x, y};
+
+ vg_float_to_datatype(p->datatype, common_data, data, 2);
+ path_append_data(p, 1, &segment, common_data);
+}
+
+void path_line_to(struct path *p, float x, float y)
+{
+ VGubyte segment = VG_LINE_TO_ABS;
+ VGubyte common_data[sizeof(VGfloat) * 2];
+ VGfloat data[2] = {x, y};
+
+ vg_float_to_datatype(p->datatype, common_data, data, 2);
+
+ path_append_data(p, 1, &segment, common_data);
+}
+
+void path_cubic_to(struct path *p, float px1, float py1,
+ float px2, float py2,
+ float x, float y)
+{
+ VGubyte segment = VG_CUBIC_TO_ABS;
+ VGubyte common_data[sizeof(VGfloat) * 6];
+ VGfloat data[6];
+
+ data[0] = px1; data[1] = py1;
+ data[2] = px2; data[3] = py2;
+ data[4] = x; data[5] = y;
+
+ vg_float_to_datatype(p->datatype, common_data, data, 6);
+
+ path_append_data(p, 1, &segment, common_data);
+}
+
+static INLINE void line_bounds(VGfloat *line /*x1,y1,x2,y2*/,
+ VGfloat *bounds)
+{
+ bounds[0] = MIN2(line[0], line[2]);
+ bounds[1] = MIN2(line[1], line[3]);
+ bounds[2] = MAX2(line[0], line[2]) - bounds[0];
+ bounds[3] = MAX2(line[1], line[3]) - bounds[1];
+}
+
+static INLINE void unite_bounds(VGfloat *bounds,
+ VGfloat *el)
+{
+ VGfloat cx1, cy1, cx2, cy2;
+ VGfloat nx1, ny1, nx2, ny2;
+
+ cx1 = bounds[0];
+ cy1 = bounds[1];
+ cx2 = bounds[0] + bounds[2];
+ cy2 = bounds[1] + bounds[3];
+
+ nx1 = el[0];
+ ny1 = el[1];
+ nx2 = el[0] + el[2];
+ ny2 = el[1] + el[3];
+
+ bounds[0] = MIN2(cx1, nx1);
+ bounds[1] = MIN2(cy1, ny1);
+ bounds[2] = MAX2(cx2, nx2) - bounds[0];
+ bounds[3] = MAX2(cy2, ny2) - bounds[1];
+}
+
+static INLINE void set_bounds(VGfloat *bounds,
+ VGfloat *element_bounds,
+ VGboolean *initialized)
+{
+ if (!(*initialized)) {
+ memcpy(bounds, element_bounds, 4 * sizeof(VGfloat));
+ *initialized = VG_TRUE;
+ } else
+ unite_bounds(bounds, element_bounds);
+}
+
+void path_bounding_rect(struct path *p, float *x, float *y,
+ float *w, float *h)
+{
+ VGint i;
+ VGfloat coords[8];
+ struct path_iter_data iter;
+ VGint num_coords;
+ VGfloat bounds[4];
+ VGfloat element_bounds[4];
+ VGfloat ox, oy;
+ VGboolean bounds_inited = VG_FALSE;
+
+ memset(&iter, 0, sizeof(struct path_iter_data));
+ memset(&bounds, 0, sizeof(bounds));
+
+ if (!p->num_segments) {
+ bounds[2] = -1;
+ bounds[3] = -1;
+ }
+
+
+ iter.path = p;
+ iter.coords = p->control_points->data;
+
+ for (i = 0; i < p->num_segments; ++i) {
+ VGubyte segment;
+ iter.segment = ((VGubyte*)(p->segments->data))[i];
+
+ ox = iter.ox;
+ oy = iter.oy;
+
+ segment = normalize_coords(&iter, &num_coords, coords);
+
+ switch(segment) {
+ case VG_CLOSE_PATH:
+ case VG_MOVE_TO_ABS:
+ break;
+ case VG_LINE_TO_ABS: {
+ VGfloat line[4] = {ox, oy, coords[0], coords[1]};
+ line_bounds(line, element_bounds);
+ set_bounds(bounds, element_bounds, &bounds_inited);
+ }
+ break;
+ case VG_CUBIC_TO_ABS: {
+ struct bezier bezier;
+ bezier_init(&bezier, ox, oy,
+ coords[0], coords[1],
+ coords[2], coords[3],
+ coords[4], coords[5]);
+ bezier_exact_bounds(&bezier, element_bounds);
+ set_bounds(bounds, element_bounds, &bounds_inited);
+ }
+ break;
+ case VG_SCCWARC_TO:
+ case VG_SCWARC_TO:
+ case VG_LCCWARC_TO:
+ case VG_LCWARC_TO: {
+ struct arc arc;
+ struct matrix identity;
+ struct path *path = path_create(VG_PATH_DATATYPE_F,
+ 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL);
+
+ matrix_load_identity(&identity);
+ arc_init(&arc, segment,
+ ox, oy, coords[3], coords[4],
+ coords[0], coords[1], coords[2]);
+
+ arc_to_path(&arc, path, &identity);
+
+ path_bounding_rect(path, element_bounds + 0, element_bounds + 1,
+ element_bounds + 2, element_bounds + 3);
+ set_bounds(bounds, element_bounds, &bounds_inited);
+ }
+ break;
+ default:
+ assert(0);
+ }
+ }
+
+ *x = bounds[0];
+ *y = bounds[1];
+ *w = bounds[2];
+ *h = bounds[3];
+}
+
+float path_length(struct path *p, int start_segment, int num_segments)
+{
+ VGint i;
+ VGfloat coords[8];
+ struct path_iter_data iter;
+ VGint num_coords;
+ VGfloat length = 0;
+ VGfloat ox, oy;
+ VGboolean in_range = VG_FALSE;
+
+ memset(&iter, 0, sizeof(struct path_iter_data));
+
+ iter.path = p;
+ iter.coords = p->control_points->data;
+
+ for (i = 0; i < (start_segment + num_segments); ++i) {
+ VGubyte segment;
+
+ iter.segment = ((VGubyte*)(p->segments->data))[i];
+
+ ox = iter.ox;
+ oy = iter.oy;
+
+ segment = normalize_coords(&iter, &num_coords, coords);
+
+ in_range = (i >= start_segment) && i <= (start_segment + num_segments);
+ if (!in_range)
+ continue;
+
+ switch(segment) {
+ case VG_MOVE_TO_ABS:
+ break;
+ case VG_CLOSE_PATH: {
+ VGfloat line[4] = {ox, oy, iter.sx, iter.sy};
+ length += line_lengthv(line);
+ }
+ break;
+ case VG_LINE_TO_ABS: {
+ VGfloat line[4] = {ox, oy, coords[0], coords[1]};
+ length += line_lengthv(line);
+ }
+ break;
+ case VG_CUBIC_TO_ABS: {
+ struct bezier bezier;
+ bezier_init(&bezier, ox, oy,
+ coords[0], coords[1],
+ coords[2], coords[3],
+ coords[4], coords[5]);
+ length += bezier_length(&bezier, BEZIER_DEFAULT_ERROR);
+ }
+ break;
+ case VG_SCCWARC_TO:
+ case VG_SCWARC_TO:
+ case VG_LCCWARC_TO:
+ case VG_LCWARC_TO: {
+ struct arc arc;
+ struct matrix identity;
+ struct path *path = path_create(VG_PATH_DATATYPE_F,
+ 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL);
+
+ matrix_load_identity(&identity);
+ arc_init(&arc, segment,
+ ox, oy, coords[3], coords[4],
+ coords[0], coords[1], coords[2]);
+
+ arc_to_path(&arc, path, &identity);
+
+ length += path_length(path, 0, path_num_segments(path));
+ }
+ break;
+ default:
+ assert(0);
+ }
+ }
+
+ return length;
+}
+
+static INLINE VGboolean point_on_current_segment(VGfloat distance,
+ VGfloat length,
+ VGfloat segment_length)
+{
+ return
+ (((floatIsZero(distance) || distance < 0) && floatIsZero(length)) ||
+ ((distance > length || floatsEqual(distance, length)) &&
+ (floatsEqual(distance, length + segment_length) ||
+ distance < (length + segment_length))));
+}
+
+static VGboolean path_point_segment(struct path_iter_data iter,
+ struct path_iter_data prev_iter,
+ VGfloat coords[8],
+ VGfloat distance,
+ VGfloat length, VGfloat *current_length,
+ VGfloat *point, VGfloat *normal)
+{
+ switch (iter.segment) {
+ case VG_MOVE_TO_ABS:
+ break;
+ case VG_CLOSE_PATH: {
+ VGfloat line[4] = {prev_iter.ox, prev_iter.oy, iter.sx, iter.sy};
+ VGboolean on_current_segment = VG_FALSE;
+ *current_length = line_lengthv(line);
+ on_current_segment = point_on_current_segment(distance,
+ length,
+ *current_length);
+ if (on_current_segment) {
+ VGfloat at = (distance - length) / line_lengthv(line);
+ line_normal_vector(line, normal);
+ line_point_at(line, at, point);
+ return VG_TRUE;
+ }
+ }
+ break;
+ case VG_LINE_TO_ABS: {
+ VGfloat line[4] = {prev_iter.ox, prev_iter.oy, coords[0], coords[1]};
+ VGboolean on_current_segment = VG_FALSE;
+ *current_length = line_lengthv(line);
+ on_current_segment = point_on_current_segment(distance,
+ length,
+ *current_length);
+ if (on_current_segment) {
+ VGfloat at = (distance - length) / line_lengthv(line);
+ line_normal_vector(line, normal);
+ line_point_at(line, at, point);
+ return VG_TRUE;
+ }
+ }
+ break;
+ case VG_CUBIC_TO_ABS: {
+ struct bezier bezier;
+ bezier_init(&bezier, prev_iter.ox, prev_iter.oy,
+ coords[0], coords[1],
+ coords[2], coords[3],
+ coords[4], coords[5]);
+ *current_length = bezier_length(&bezier, BEZIER_DEFAULT_ERROR);
+ if (point_on_current_segment(distance, length, *current_length)) {
+ bezier_point_at_length(&bezier, distance - length,
+ point, normal);
+ return VG_TRUE;
+ }
+ }
+ break;
+ case VG_SCCWARC_TO:
+ case VG_SCWARC_TO:
+ case VG_LCCWARC_TO:
+ case VG_LCWARC_TO: {
+ struct arc arc;
+ struct matrix identity;
+ struct path *path = path_create(VG_PATH_DATATYPE_F,
+ 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL);
+
+ matrix_load_identity(&identity);
+ arc_init(&arc, iter.segment,
+ prev_iter.ox, prev_iter.oy, coords[3], coords[4],
+ coords[0], coords[1], coords[2]);
+
+ arc_to_path(&arc, path, &identity);
+
+ *current_length = path_length(path, 0, path_num_segments(path));
+ if (point_on_current_segment(distance, length, *current_length)) {
+ path_point(path, 0, path_num_segments(path),
+ distance - length, point, normal);
+ return VG_TRUE;
+ }
+ }
+ break;
+ default:
+ assert(0);
+ }
+ return VG_FALSE;
+}
+
+void path_point(struct path *p, VGint start_segment, VGint num_segments,
+ VGfloat distance, VGfloat *point, VGfloat *normal)
+{
+ VGint i;
+ VGfloat coords[8];
+ struct path_iter_data iter, prev_iter;
+ VGint num_coords;
+ VGfloat length = 0;
+ VGfloat current_length = 0;
+
+ memset(&iter, 0, sizeof(struct path_iter_data));
+ memset(&prev_iter, 0, sizeof(struct path_iter_data));
+
+ point[0] = 0;
+ point[1] = 0;
+
+ normal[0] = 0;
+ normal[1] = -1;
+
+ iter.path = p;
+ iter.coords = p->control_points->data;
+ if (distance < 0)
+ distance = 0;
+
+ for (i = 0; i < (start_segment + num_segments); ++i) {
+ VGboolean outside_range = (i < start_segment ||
+ i >= (start_segment + num_segments));
+
+ prev_iter = iter;
+
+ iter.segment = ((VGubyte*)(p->segments->data))[i];
+ iter.segment = normalize_coords(&iter, &num_coords, coords);
+
+ if (outside_range)
+ continue;
+
+ if (path_point_segment(iter, prev_iter, coords,
+ distance, length, &current_length,
+ point, normal))
+ return;
+
+ length += current_length;
+ }
+
+ /*
+ *OpenVG 1.0 - 8.6.11 vgPointAlongPath
+ *
+ * If distance is greater than or equal to the path length
+ *(i.e., the value returned by vgPathLength when called with the same
+ *startSegment and numSegments parameters), the visual ending point of
+ *the path is used.
+ */
+ {
+ switch (iter.segment) {
+ case VG_MOVE_TO_ABS:
+ break;
+ case VG_CLOSE_PATH: {
+ VGfloat line[4] = {prev_iter.ox, prev_iter.oy, iter.sx, iter.sy};
+ line_normal_vector(line, normal);
+ line_point_at(line, 1.f, point);
+ }
+ break;
+ case VG_LINE_TO_ABS: {
+ VGfloat line[4] = {prev_iter.ox, prev_iter.oy, coords[0], coords[1]};
+ line_normal_vector(line, normal);
+ line_point_at(line, 1.f, point);
+ }
+ break;
+ case VG_CUBIC_TO_ABS: {
+ struct bezier bezier;
+ bezier_init(&bezier, prev_iter.ox, prev_iter.oy,
+ coords[0], coords[1],
+ coords[2], coords[3],
+ coords[4], coords[5]);
+ bezier_point_at_t(&bezier, 1.f, point, normal);
+ }
+ break;
+ case VG_SCCWARC_TO:
+ case VG_SCWARC_TO:
+ case VG_LCCWARC_TO:
+ case VG_LCWARC_TO: {
+ struct arc arc;
+ struct matrix identity;
+ struct path *path = path_create(VG_PATH_DATATYPE_F,
+ 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL);
+
+ matrix_load_identity(&identity);
+ arc_init(&arc, iter.segment,
+ prev_iter.ox, prev_iter.oy, coords[3], coords[4],
+ coords[0], coords[1], coords[2]);
+
+ arc_to_path(&arc, path, &identity);
+
+ path_point(path, 0, path_num_segments(path),
+ /* to make sure we're bigger than len * 2 it */
+ 2 * path_length(path, 0, path_num_segments(path)),
+ point, normal);
+ }
+ break;
+ default:
+ assert(0);
+ }
+ }
+}
+
+VGboolean path_is_empty(struct path *p)
+{
+ return p->segments->num_elements == 0;
+}
diff --git a/src/gallium/state_trackers/vega/path.h b/src/gallium/state_trackers/vega/path.h
new file mode 100644
index 00000000000..e34538b7368
--- /dev/null
+++ b/src/gallium/state_trackers/vega/path.h
@@ -0,0 +1,126 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef _PATH_H
+#define _PATH_H
+
+#include "VG/openvg.h"
+
+struct path;
+struct polygon;
+struct matrix;
+
+enum fill_rule {
+ ODD_EVEN_FILL,
+ WINDING_FILL
+};
+
+
+struct path_for_each_data {
+ VGubyte segment;
+ /* all coords are absolute, even if segment is relative */
+ const VGfloat *coords;
+ VGfloat sx, sy, ox, oy, px, py;
+ void *user_data;
+};
+
+typedef VGboolean (*path_for_each_cb)(struct path *p,
+ struct path_for_each_data *data);
+
+
+struct path *path_create(VGPathDatatype dt, VGfloat scale, VGfloat bias,
+ VGint segmentCapacityHint,
+ VGint coordCapacityHint,
+ VGbitfield capabilities);
+void path_destroy(struct path *p);
+
+VGbitfield path_capabilities(struct path *p);
+void path_set_capabilities(struct path *p, VGbitfield bf);
+
+void path_append_data(struct path *p,
+ VGint numSegments,
+ const VGubyte * pathSegments,
+ const void * pathData);
+
+void path_append_path(struct path *dst,
+ struct path *src);
+
+VGint path_num_segments(struct path *p);
+
+void path_bounding_rect(struct path *p, float *x, float *y,
+ float *w, float *h);
+float path_length(struct path *p, int start_segment, int num_segments);
+
+void path_set_fill_rule(enum fill_rule fill);
+enum fill_rule path_fill_rule(enum fill_rule fill);
+
+VGboolean path_is_empty(struct path *p);
+
+VGbyte path_datatype_size(struct path *p);
+
+VGPathDatatype path_datatype(struct path *p);
+VGfloat path_scale(struct path *p);
+VGfloat path_bias(struct path *p);
+VGint path_num_coords(struct path *p);
+
+void path_modify_coords(struct path *p,
+ VGint startIndex,
+ VGint numSegments,
+ const void * pathData);
+
+struct path *path_create_stroke(struct path *p,
+ struct matrix *m);
+
+void path_for_each_segment(struct path *path,
+ path_for_each_cb cb,
+ void *user_data);
+
+void path_transform(struct path *dst, struct path *src);
+VGboolean path_interpolate(struct path *dst,
+ struct path *start, struct path *end,
+ VGfloat amount);
+
+void path_clear(struct path *p, VGbitfield capabilities);
+void path_render(struct path *p, VGbitfield paintModes);
+void path_fill(struct path *p, struct matrix *mat);
+void path_stroke(struct path *p);
+
+void path_move_to(struct path *p, float x, float y);
+void path_line_to(struct path *p, float x, float y);
+void path_cubic_to(struct path *p, float px1, float py1,
+ float px2, float py2,
+ float x, float y);
+
+void path_point(struct path *p, VGint startSegment, VGint numSegments,
+ VGfloat distance, VGfloat *point, VGfloat *normal);
+
+
+
+void vg_float_to_datatype(VGPathDatatype datatype,
+ VGubyte *common_data,
+ const VGfloat *data,
+ VGint num_coords);
+#endif
diff --git a/src/gallium/state_trackers/vega/path_utils.h b/src/gallium/state_trackers/vega/path_utils.h
new file mode 100644
index 00000000000..c2b3221dc53
--- /dev/null
+++ b/src/gallium/state_trackers/vega/path_utils.h
@@ -0,0 +1,109 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#ifndef PATH_UTILS_H
+#define PATH_UTILS_H
+
+#include "VG/openvg.h"
+
+#define SEGMENT_COMMAND(command) /* Extract segment type */ \
+ ((command) & 0x1e)
+#define SEGMENT_ABS_REL(command) /* Extract absolute/relative bit */ \
+ ((command) & 0x1)
+
+static INLINE VGint size_for_datatype(VGPathDatatype datatype)
+{
+ switch(datatype) {
+ case VG_PATH_DATATYPE_S_8:
+ return 1;
+ case VG_PATH_DATATYPE_S_16:
+ return 2;
+ case VG_PATH_DATATYPE_S_32:
+ return 4;
+ case VG_PATH_DATATYPE_F:
+ return 4;
+ default:
+ assert(!"unknown datatype");
+ }
+ return 0;
+}
+
+static INLINE VGint num_elements_for_segments(const VGubyte *segments,
+ VGint num_segments)
+{
+ VGint i;
+ VGint count = 0;
+
+ for (i = 0; i < num_segments; ++i) {
+ VGubyte segment = segments[i];
+ VGint command = SEGMENT_COMMAND(segment);
+ switch(command) {
+ case VG_CLOSE_PATH:
+ break;
+ case VG_MOVE_TO:
+ count += 2;
+ break;
+ case VG_LINE_TO:
+ count += 2;
+ break;
+ case VG_HLINE_TO:
+ count += 1;
+ break;
+ case VG_VLINE_TO:
+ count += 1;
+ break;
+ case VG_QUAD_TO:
+ count += 4;
+ break;
+ case VG_CUBIC_TO:
+ count += 6;
+ break;
+ case VG_SQUAD_TO:
+ count += 2;
+ break;
+ case VG_SCUBIC_TO:
+ count += 4;
+ break;
+ case VG_SCCWARC_TO:
+ count += 5;
+ break;
+ case VG_SCWARC_TO:
+ count += 5;
+ break;
+ case VG_LCCWARC_TO:
+ count += 5;
+ break;
+ case VG_LCWARC_TO:
+ count += 5;
+ break;
+ default:
+ assert(!"Unknown segment!");
+ }
+ }
+ return count;
+}
+
+#endif
diff --git a/src/gallium/state_trackers/vega/polygon.c b/src/gallium/state_trackers/vega/polygon.c
new file mode 100644
index 00000000000..b6d282d803b
--- /dev/null
+++ b/src/gallium/state_trackers/vega/polygon.c
@@ -0,0 +1,550 @@
+/**************************************************************************
+ *
+ * Copyright 2009 VMware, Inc. All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the
+ * "Software"), to deal in the Software without restriction, including
+ * without limitation the rights to use, copy, modify, merge, publish,
+ * distribute, sub license, and/or sell copies of the Software, and to
+ * permit persons to whom the Software is furnished to do so, subject to
+ * the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the
+ * next paragraph) shall be included in all copies or substantial portions
+ * of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS
+ * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT.
+ * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR
+ * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+ * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+ *
+ **************************************************************************/
+
+#include "polygon.h"
+
+#include "matrix.h" /*for floatsEqual*/
+#include "vg_context.h"
+#include "vg_state.h"
+#include "paint.h"
+#include "renderer.h"
+#include "util_array.h"
+#include "VG/openvg.h"
+
+#include "pipe/p_context.h"
+#include "pipe/p_defines.h"
+#include "pipe/p_state.h"
+#include "pipe/p_inlines.h"
+#include "pipe/p_screen.h"
+
+#include "util/u_draw_quad.h"
+#include "util/u_math.h"
+
+#include <string.h>
+#include <stdlib.h>
+
+#define DEBUG_POLYGON 0
+
+#define COMPONENTS 2
+
+struct polygon
+{
+ VGfloat *data;
+ VGint size;
+
+ VGint num_verts;
+
+ VGboolean dirty;
+ struct pipe_buffer *vbuf;
+ struct pipe_screen *screen;
+};
+
+static float *ptr_to_vertex(float *data, int idx)
+{
+ return data + (idx * COMPONENTS);
+}
+
+#if 0
+static void polygon_print(struct polygon *poly)
+{
+ int i;
+ float *vert;
+ debug_printf("Polygon %p, size = %d\n", poly, poly->num_verts);
+ for (i = 0; i < poly->num_verts; ++i) {
+ vert = ptr_to_vertex(poly->data, i);
+ debug_printf("%f, %f, ", vert[0], vert[1]);
+ }
+ debug_printf("\nend\n");
+}
+#endif
+
+
+struct polygon * polygon_create(int size)
+{
+ struct polygon *poly = (struct polygon*)malloc(sizeof(struct polygon));
+
+ poly->data = malloc(sizeof(float) * COMPONENTS * size);
+ poly->size = size;
+ poly->num_verts = 0;
+ poly->dirty = VG_TRUE;
+ poly->vbuf = NULL;
+
+ return poly;
+}
+
+struct polygon * polygon_create_from_data(float *data, int size)
+{
+ struct polygon *poly = polygon_create(size);
+
+ memcpy(poly->data, data, sizeof(float) * COMPONENTS * size);
+ poly->num_verts = size;
+ poly->dirty = VG_TRUE;
+ poly->vbuf = NULL;
+
+ return poly;
+}
+
+void polygon_destroy(struct polygon *poly)
+{
+ if (poly->vbuf)
+ pipe_buffer_reference(&poly->vbuf, NULL);
+
+ free(poly->data);
+ free(poly);
+}
+
+void polygon_resize(struct polygon *poly, int new_size)
+{
+ float *data = (float*)malloc(sizeof(float) * COMPONENTS * new_size);
+ int size = MIN2(sizeof(float) * COMPONENTS * new_size,
+ sizeof(float) * COMPONENTS * poly->size);
+ memcpy(data, poly->data, size);
+ free(poly->data);
+ poly->data = data;
+ poly->size = new_size;
+ poly->dirty = VG_TRUE;
+}
+
+int polygon_size(struct polygon *poly)
+{
+ return poly->size;
+}
+
+int polygon_vertex_count(struct polygon *poly)
+{
+ return poly->num_verts;
+}
+
+float * polygon_data(struct polygon *poly)
+{
+ return poly->data;
+}
+
+void polygon_vertex_append(struct polygon *p,
+ float x, float y)
+{
+ float *vert;
+#if DEBUG_POLYGON
+ debug_printf("Append vertex [%f, %f]\n", x, y);
+#endif
+ if (p->num_verts >= p->size) {
+ polygon_resize(p, p->size * 2);
+ }
+
+ vert = ptr_to_vertex(p->data, p->num_verts);
+ vert[0] = x;
+ vert[1] = y;
+ ++p->num_verts;
+ p->dirty = VG_TRUE;
+}
+
+void polygon_set_vertex(struct polygon *p, int idx,
+ float x, float y)
+{
+ float *vert;
+ if (idx >= p->num_verts) {
+ /*fixme: error reporting*/
+ abort();
+ return;
+ }
+
+ vert = ptr_to_vertex(p->data, idx);
+ vert[0] = x;
+ vert[1] = y;
+ p->dirty = VG_TRUE;
+}
+
+void polygon_vertex(struct polygon *p, int idx,
+ float *vertex)
+{
+ float *vert;
+ if (idx >= p->num_verts) {
+ /*fixme: error reporting*/
+ abort();
+ return;
+ }
+
+ vert = ptr_to_vertex(p->data, idx);
+ vertex[0] = vert[0];
+ vertex[1] = vert[1];
+}
+
+void polygon_bounding_rect(struct polygon *p,
+ float *rect)
+{
+ int i;
+ float minx, miny, maxx, maxy;
+ float *vert = ptr_to_vertex(p->data, 0);
+ minx = vert[0];
+ maxx = vert[0];
+ miny = vert[1];
+ maxy = vert[1];
+
+ for (i = 1; i < p->num_verts; ++i) {
+ vert = ptr_to_vertex(p->data, i);
+ minx = MIN2(vert[0], minx);
+ miny = MIN2(vert[1], miny);
+
+ maxx = MAX2(vert[0], maxx);
+ maxy = MAX2(vert[1], maxy);
+ }
+
+ rect[0] = minx;
+ rect[1] = miny;
+ rect[2] = maxx - minx;
+ rect[3] = maxy - miny;
+}
+
+int polygon_contains_point(struct polygon *p,
+ float x, float y)
+{
+ return 0;
+}
+
+void polygon_append_polygon(struct polygon *dst,
+ struct polygon *src)
+{
+ if (dst->num_verts + src->num_verts >= dst->size) {
+ polygon_resize(dst, dst->num_verts + src->num_verts * 1.5);
+ }
+ memcpy(ptr_to_vertex(dst->data, dst->num_verts),
+ src->data, src->num_verts * COMPONENTS * sizeof(VGfloat));
+ dst->num_verts += src->num_verts;
+}
+
+VGboolean polygon_is_closed(struct polygon *p)
+{
+ VGfloat start[2], end[2];
+
+ polygon_vertex(p, 0, start);
+ polygon_vertex(p, p->num_verts - 1, end);
+
+ return floatsEqual(start[0], end[0]) && floatsEqual(start[1], end[1]);
+}
+
+static void set_blend_for_fill(struct pipe_blend_state *blend)
+{
+ memset(blend, 0, sizeof(struct pipe_blend_state));
+ blend->colormask = 0; /*disable colorwrites*/
+
+ blend->rgb_src_factor = PIPE_BLENDFACTOR_ONE;
+ blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE;
+ blend->rgb_dst_factor = PIPE_BLENDFACTOR_INV_SRC_ALPHA;
+ blend->alpha_dst_factor = PIPE_BLENDFACTOR_INV_SRC_ALPHA;
+}
+
+static void draw_polygon(struct vg_context *ctx,
+ struct polygon *poly)
+{
+ int vert_size;
+ struct pipe_context *pipe;
+ struct pipe_vertex_buffer vbuffer;
+ struct pipe_vertex_element velement;
+
+ vert_size = poly->num_verts * COMPONENTS * sizeof(float);
+
+ /*polygon_print(poly);*/
+
+ pipe = ctx->pipe;
+
+ if (poly->vbuf == NULL || poly->dirty) {
+ if (poly->vbuf) {
+ pipe_buffer_reference(&poly->vbuf,
+ NULL);
+ }
+ poly->screen = pipe->screen;
+ poly->vbuf= pipe_user_buffer_create(poly->screen,
+ poly->data,
+ vert_size);
+ poly->dirty = VG_FALSE;
+ }
+
+
+ /* tell pipe about the vertex buffer */
+ memset(&vbuffer, 0, sizeof(vbuffer));
+ vbuffer.buffer = poly->vbuf;
+ vbuffer.stride = COMPONENTS * sizeof(float); /* vertex size */
+ vbuffer.buffer_offset = 0;
+ vbuffer.max_index = poly->num_verts - 1;
+ pipe->set_vertex_buffers(pipe, 1, &vbuffer);
+
+ /* tell pipe about the vertex attributes */
+ velement.src_offset = 0;
+ velement.vertex_buffer_index = 0;
+ velement.src_format = PIPE_FORMAT_R32G32_FLOAT;
+ velement.nr_components = COMPONENTS;
+ pipe->set_vertex_elements(pipe, 1, &velement);
+
+ /* draw */
+ pipe->draw_arrays(pipe, PIPE_PRIM_TRIANGLE_FAN,
+ 0, poly->num_verts);
+}
+
+void polygon_fill(struct polygon *poly, struct vg_context *ctx)
+{
+ struct pipe_depth_stencil_alpha_state dsa;
+ struct pipe_blend_state blend;
+ VGfloat bounds[4];
+ VGfloat min_x, min_y, max_x, max_y;
+ assert(poly);
+ polygon_bounding_rect(poly, bounds);
+ min_x = bounds[0];
+ min_y = bounds[1];
+ max_x = bounds[0] + bounds[2];
+ max_y = bounds[1] + bounds[3];
+
+#if DEBUG_POLYGON
+ debug_printf("Poly bounds are [%f, %f], [%f, %f]\n",
+ min_x, min_y, max_x, max_y);
+#endif
+
+ set_blend_for_fill(&blend);
+
+ memset(&dsa, 0, sizeof(struct pipe_depth_stencil_alpha_state));
+
+ cso_save_blend(ctx->cso_context);
+ cso_save_depth_stencil_alpha(ctx->cso_context);
+
+ dsa.stencil[0].enabled = 1;
+ if (ctx->state.vg.fill_rule == VG_EVEN_ODD) {
+ dsa.stencil[0].writemask = 1;
+ dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INVERT;
+ dsa.stencil[0].func = PIPE_FUNC_ALWAYS;
+ dsa.stencil[0].ref_value = 0;
+ dsa.stencil[0].valuemask = ~0;
+
+ cso_set_blend(ctx->cso_context, &blend);
+ cso_set_depth_stencil_alpha(ctx->cso_context, &dsa);
+ draw_polygon(ctx, poly);
+ } else if (ctx->state.vg.fill_rule == VG_NON_ZERO) {
+ struct pipe_screen *screen = ctx->pipe->screen;
+
+ if (screen->get_param(screen, PIPE_CAP_TWO_SIDED_STENCIL)) {
+ /* front */
+ dsa.stencil[0].writemask = ~0;
+ dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INCR_WRAP;
+ dsa.stencil[0].func = PIPE_FUNC_ALWAYS;
+ dsa.stencil[0].ref_value = 0;
+ dsa.stencil[0].valuemask = ~0;
+
+ /* back */
+ dsa.stencil[1].enabled = 1;
+ dsa.stencil[1].writemask = ~0;
+ dsa.stencil[1].fail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[1].zfail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[1].zpass_op = PIPE_STENCIL_OP_DECR_WRAP;
+ dsa.stencil[1].func = PIPE_FUNC_ALWAYS;
+ dsa.stencil[1].ref_value = 0;
+ dsa.stencil[1].valuemask = ~0;
+
+ cso_set_blend(ctx->cso_context, &blend);
+ cso_set_depth_stencil_alpha(ctx->cso_context, &dsa);
+ draw_polygon(ctx, poly);
+ } else {
+ struct pipe_rasterizer_state raster;
+
+ memcpy(&raster, &ctx->state.g3d.rasterizer, sizeof(struct pipe_rasterizer_state));
+
+ cso_save_rasterizer(ctx->cso_context);
+ dsa.stencil[0].func = PIPE_FUNC_ALWAYS;
+ dsa.stencil[0].ref_value = 0;
+ dsa.stencil[0].valuemask = ~0;
+
+ raster.cull_mode = raster.front_winding ^ PIPE_WINDING_BOTH;
+ dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INCR_WRAP;
+
+ cso_set_blend(ctx->cso_context, &blend);
+ cso_set_depth_stencil_alpha(ctx->cso_context, &dsa);
+ cso_set_rasterizer(ctx->cso_context, &raster);
+ draw_polygon(ctx, poly);
+
+ raster.cull_mode = raster.front_winding;
+ dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_DECR_WRAP;
+ cso_set_depth_stencil_alpha(ctx->cso_context, &dsa);
+ cso_set_rasterizer(ctx->cso_context, &raster);
+ draw_polygon(ctx, poly);
+
+ cso_restore_rasterizer(ctx->cso_context);
+ }
+ }
+
+ /* restore color writes */
+ cso_restore_blend(ctx->cso_context);
+ /* setup stencil ops */
+ dsa.stencil[0].func = PIPE_FUNC_NOTEQUAL;
+ dsa.stencil[0].fail_op = PIPE_STENCIL_OP_REPLACE;
+ dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_REPLACE;
+ dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_REPLACE;
+ dsa.stencil[0].ref_value = 0;
+ dsa.stencil[0].valuemask = dsa.stencil[0].writemask;
+ dsa.stencil[1].enabled = 0;
+ memcpy(&dsa.depth, &ctx->state.g3d.dsa.depth,
+ sizeof(struct pipe_depth_state));
+ cso_set_depth_stencil_alpha(ctx->cso_context, &dsa);
+
+ /* render the quad to propagate the rendering from stencil */
+ renderer_draw_quad(ctx->renderer, min_x, min_y,
+ max_x, max_y, 0.0f/*depth should be disabled*/);
+
+ cso_restore_depth_stencil_alpha(ctx->cso_context);
+}
+
+void polygon_array_fill(struct polygon_array *polyarray, struct vg_context *ctx)
+{
+ struct array *polys = polyarray->array;
+ struct pipe_depth_stencil_alpha_state dsa;
+ struct pipe_blend_state blend;
+ VGfloat min_x = polyarray->min_x;
+ VGfloat min_y = polyarray->min_y;
+ VGfloat max_x = polyarray->max_x;
+ VGfloat max_y = polyarray->max_y;
+ VGint i;
+
+
+#if DEBUG_POLYGON
+ debug_printf("%s: Poly bounds are [%f, %f], [%f, %f]\n",
+ __FUNCTION__,
+ min_x, min_y, max_x, max_y);
+#endif
+
+ set_blend_for_fill(&blend);
+
+ memset(&dsa, 0, sizeof(struct pipe_depth_stencil_alpha_state));
+
+ cso_save_blend(ctx->cso_context);
+ cso_save_depth_stencil_alpha(ctx->cso_context);
+
+ dsa.stencil[0].enabled = 1;
+ if (ctx->state.vg.fill_rule == VG_EVEN_ODD) {
+ dsa.stencil[0].writemask = 1;
+ dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP;
+ dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INVERT;
+ dsa.stencil